KEGG   Mycobacterium intracellulare MOTT-64: OCQ_04760Help
Entry
OCQ_04760         CDS       T01755                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
mir  Mycobacterium intracellulare MOTT-64
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mir00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
471591..472100
Genome map
AA seq 169 aa AA seqDB search
MVLSIGSNLGDRLARLQSVVDGLGDAVLAVSPVYETDPWGRVDQAPFLNAVLIADDPACD
GQGWLARAQEFERAAGRVRGERWGPRTLDVDLIACYGQAEVTSRENNLTLPHPLAHLRAF
VLIPWLAVDPDARLTVAEGPRPVAQLLAELEPADRAAVRRSDLTLELTT
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
gtggtgttgtccatcgggtccaacctgggggaccggctggcgcggttgcagtcggtcgtc
gacgggctgggggacgcggtgctcgccgtgtcaccggtgtacgagaccgacccctggggc
cgggtcgatcaggcgccgttcctgaacgcggtgctgatcgccgacgacccggcctgcgac
gggcagggctggctggcccgggcgcaggagttcgagcgcgcggcgggcagggtccgcggc
gagcgctgggggccgcgcaccctcgacgtcgacctgatcgcctgttacgggcaagctgag
gtgacctcgcgggagaacaacctgacgctcccgcatccgctggcccatttgcgggccttc
gtgctgatcccctggctggcggtcgacccggacgctcggctgacggtcgccgaagggccg
cgtcccgtcgcgcagttgctggccgaactggagcccgccgaccgtgccgccgtacggcgc
tccgacctgacgctcgagctcacaacctga

DBGET integrated database retrieval system