KEGG   Mycobacterium intracellulare MOTT-64: OCQ_05400Help
Entry
OCQ_05400         CDS       T01755                                 

Definition
acetyl-CoA acetyltransferase
Orthology
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mir  Mycobacterium intracellulare MOTT-64
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Two-component system
Class
Metabolism; Overview; Carbon metabolism [PATH:mir01200]
Metabolism; Overview; Fatty acid metabolism [PATH:mir01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mir00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:mir00630]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mir00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mir00650]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:mir00071]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:mir00072]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:mir00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:mir00310]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:mir00380]
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:mir00900]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:mir00362]
Environmental Information Processing; Signal transduction; Two-component system [PATH:mir02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(531938..533101)
Genome map
AA seq 387 aa AA seqDB search
MGNPVIVEATRSPIGKRNGWLSGLHATELLGAVQKALVEKAGIEAGDVEQVIGGCVTQYG
EQSNNISRVSWLVAGLPEHVGAMTVDCQCGSGQQANGLVAGLIAAGAIDIGIACGIEAMS
RVGLGANAGPDRSILRPASWDIDLPDQFTAAERIAKRRGITREEIDEFGFNSQARAKQAW
DEGRFDREISPIEAPALDENKQPTSERVTISRDQGLRETTLSGLSALKPVLEGGIHTAGT
SSQISDGAAAVLWMDEDKAKALGLRPRARIVSQALVGAEPYYHLDGPVQSTAKVLEKAGM
KMGDIDLVEINEAFASVVLSWARVHEPDMARVNVNGGAIALGHPVGSTGSRLITTALHEL
ERTDQTTALITMCAGGALSTGTIIERI
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacccggtaatcgtcgaagccactcgcagcccgatcggcaagcgcaatggctgg
ttgtcagggctgcacgccaccgagctgttgggtgcggtgcagaaggcgctggttgagaag
gcaggcatcgaagccggcgacgtcgaacaggtcatcggcggctgcgtcacgcagtacggc
gaacagtccaacaacatcagccgggtcagctggctggtggccggtctgcccgagcacgtc
ggcgccatgaccgtggactgccagtgcggcagcggccagcaggccaacggcctggtcgcc
gggctgatcgccgccggcgccatcgacatcggtatcgcgtgtggcatcgaggccatgagc
cgcgtcggcctcggcgccaacgcgggccccgaccgcagcatcctgcggcccgcgtcgtgg
gacatcgacctgcccgaccagttcaccgccgccgagcggatcgccaagcggcgcggcatc
acccgcgaggagatcgacgagttcggcttcaactcgcaggccagggccaagcaggcctgg
gacgagggccgcttcgaccgtgagatctcccccatcgaggccccggcgctcgacgagaac
aagcagccgacgtcggagcgcgtcaccatctctcgcgaccagggcctgcgcgagacgacc
ctgtcgggtctgagcgcgctgaagccggtcctcgaaggcgggatccacacggcgggaacg
tcgtcgcagatctccgacggcgcggcggccgtgctgtggatggacgaggacaaggccaag
gctttgggcctgcggccgcgcgcccgcatcgtcagtcaggcgttggtcggcgccgagccc
tactaccacctcgacgggccggtgcagtcgacggccaaggtgctggagaaggccggcatg
aagatgggggacatcgacctcgtcgagatcaacgaggcgttcgcctcggtggtgttgtcc
tgggcgcgggtgcacgagccggacatggccagggtcaacgtcaacggcggcgccatcgcg
ctcggccacccggtcgggtcgaccggcagccggctgatcaccaccgcgctgcacgaattg
gagcgcaccgaccagaccaccgcattgatcacgatgtgcgcgggcggcgccctgtccacc
ggcaccatcatcgagcgcatctag

DBGET integrated database retrieval system