KEGG   Mycobacterium intracellulare MOTT-64: OCQ_05510Help
Entry
OCQ_05510         CDS       T01755                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mir  Mycobacterium intracellulare MOTT-64
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mir00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mir00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:mir00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:mir00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:mir00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
543781..544695
Genome map
AA seq 304 aa AA seqDB search
MAIVGSGNISTDLLYKLLRSDWLEPRWMVGIDPESEGLARARKLGLETTHEGVDWLLAQS
DKPDLVFEATSAYVHRDAAPKYAAAGIRAVDLTPAAVGPAVIPPANLRQHLDAPNVNMIT
CGGQATIPIVYAVSRAVADLGGVPYAEIVASVASLSAGPGTRANIDEFTKTTSKGVETIG
GAKRGKAIIILNPADPPMIMRDTIFCAIPEDADRDAIAKSIHDVVAEVQTYVPGYRLLND
PQFDDPSINSGGQALVTTFVEVEGAGDYLPPYAGNLDIMTAAATKVGEEIAKESLTATAG
GAQS
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtggccattgtcgggtcgggcaacatcagcactgacctgctttacaagttgttgcgatcg
gactggctggagccgcgctggatggtcggcatcgaccccgaaagcgagggtctggcgcgg
gcccgcaagctgggtttggagaccacccacgagggcgtggactggttgctggcgcagtcg
gacaagcccgatctggtgttcgaggcgaccagcgcctatgtgcatcgcgacgccgcgccc
aagtacgcggctgccggcatccgggccgtcgacctgacgcccgccgcggtgggtcccgcg
gtgatcccgccggccaacctgcgccagcacctggatgcgcccaacgtcaacatgatcacc
tgcggcgggcaggccaccatcccgatcgtgtacgcggtgtcgcgcgccgtcgccgacctc
ggtggggtgccgtacgccgagatcgtcgcctcggtcgcctcgctgtcggcggggccggga
acccgggccaacatcgacgagttcaccaagaccaccagcaagggcgtggagaccatcggt
ggcgccaagcgcggcaaggcgatcatcatcttgaaccccgccgatccgccgatgatcatg
cgcgacaccatcttttgcgccattcccgaggacgccgaccgcgacgcgatcgccaagtcc
atccacgacgtggtggccgaggtgcagacctacgttcccggctaccggctgctcaacgac
ccgcagttcgacgacccgtcgatcaactctggcggccaggcgctggtcaccacgttcgtc
gaggtcgagggggccggcgattacctgcccccctatgcgggcaacctggacatcatgacc
gccgcggcgaccaaggtcggcgaggagatcgccaaggaatccttgaccgcgacggccgga
ggagcgcaatcatga

DBGET integrated database retrieval system