KEGG   Mycobacterium paraintracellulare: OCQ_07390Help
Entry
OCQ_07390         CDS       T01755                                 

Definition
(GenBank) hypothetical protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mir  Mycobacterium paraintracellulare
Pathway
mir00071  Fatty acid degradation
mir00072  Synthesis and degradation of ketone bodies
mir00280  Valine, leucine and isoleucine degradation
mir00310  Lysine degradation
mir00362  Benzoate degradation
mir00380  Tryptophan metabolism
mir00620  Pyruvate metabolism
mir00630  Glyoxylate and dicarboxylate metabolism
mir00640  Propanoate metabolism
mir00650  Butanoate metabolism
mir00900  Terpenoid backbone biosynthesis
mir01100  Metabolic pathways
mir01110  Biosynthesis of secondary metabolites
mir01120  Microbial metabolism in diverse environments
mir01130  Biosynthesis of antibiotics
mir01200  Carbon metabolism
mir01212  Fatty acid metabolism
mir02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mir00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    OCQ_07390
   00630 Glyoxylate and dicarboxylate metabolism
    OCQ_07390
   00640 Propanoate metabolism
    OCQ_07390
   00650 Butanoate metabolism
    OCQ_07390
  Lipid metabolism
   00071 Fatty acid degradation
    OCQ_07390
   00072 Synthesis and degradation of ketone bodies
    OCQ_07390
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OCQ_07390
   00310 Lysine degradation
    OCQ_07390
   00380 Tryptophan metabolism
    OCQ_07390
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    OCQ_07390
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OCQ_07390
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    OCQ_07390
Enzymes [BR:mir01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     OCQ_07390
Exosome [BR:mir04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OCQ_07390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C Gemin7
Motif
Other DBs
NCBI-ProteinID: AFC52252
UniProt: A0A1X2L6E9
Position
730604..731743
Genome map
AA seq 379 aa AA seqDB search
MPEAVIVSALRTPIGTARKGTLRDTSAFDLAHHVVTEAAADLDPAQVDDVILGEGLYGGG
VLARHAALTAGLTQVPGLANNRHCAAGQAAVQSAAASVRAGMDQLVIAGGVNSASTSPRS
RMQVDGDWVDWFPPTHPDRPDAPNMDMSITVGWNAAVKAGVTREEMDAWALRSHRNAIAA
IDEGRFKEEIVPIDTPHGLFSVDEHPRRDTSMEKLAALKPLHPEIEGFSITAGNACGAND
GAAALTIASDRLGLPALATIRSWASVGVDPAITGLAPVEAIPKALGRAGLSVADVNLFEI
NEAFAAMCVATIKLLDLDPEKVNVSGSGCSLGHPVAATGARMLVTLVHELRRRGGGIGVA
AMCAGGGMGSATVIEVAAP
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgaagccgtcatcgtgtccgccctgcgcacccccatcggcacggcccgcaagggg
accctgcgcgacaccagcgcgttcgatctggcgcaccacgtcgtcaccgaagcggcagcg
gatctcgacccggcgcaggtcgacgacgtgatcctgggcgaaggcctctacggcggcggt
gtgctggcgcgccacgcggccctcaccgcgggcctgacccaggtgcccggcttggccaac
aatcgccactgcgcggcgggccaggcggccgtgcagagcgcggcggcgagcgtgcgcgcg
ggaatggaccaactcgtcatcgccggcggcgtgaactcggcatccacgtcgccgcggtcc
cggatgcaggtggacggcgactgggtcgactggttcccgccgacccacccggaccgcccc
gacgcgcccaacatggacatgtcgatcaccgtcggctggaacgccgccgtcaaggccggc
gtgacccgcgaggagatggacgcctgggcgctgcgctcgcaccgcaacgccatcgccgcc
atcgacgaaggccgcttcaaagaggagatcgtccccatcgacaccccacacgggttgttc
tcggtcgacgaacacccgcgacgcgacaccagcatggagaagctggccgcgctcaagccg
ctgcaccccgaaatcgagggcttttccatcaccgcgggcaacgcctgcggcgccaacgac
ggagccgcggcgttgacgatcgccagcgaccgactcgggctgccggcgctggccaccatc
cggtcctgggcgtcggtcggcgtcgacccggcgatcaccggtttggcgccggtcgaggcg
atcccgaaagctcttggccgcgctggcctttcggtcgcagacgtgaacctgtttgaaatc
aacgaggccttcgcggcgatgtgcgtggccaccatcaagctcctcgaccttgaccccgaa
aaggtcaacgtcagcggcagtggctgctcgctggggcatcccgtcgcggcgaccggagcc
cggatgctcgtcacactggtgcacgaattgcgccgccgcggcggcgggatcggcgtcgcg
gcgatgtgcgccggcggcgggatgggctcggcgacggtgatcgaggtcgcggctccataa

DBGET integrated database retrieval system