KEGG   Mycobacterium intracellulare MOTT-64: OCQ_08620Help
Entry
OCQ_08620         CDS       T01755                                 

Definition
putative acyl-CoA dehydrogenase
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mir  Mycobacterium intracellulare MOTT-64
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mir00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OCQ_08620
   01212 Fatty acid metabolism
    OCQ_08620
  Carbohydrate metabolism
   00640 Propanoate metabolism
    OCQ_08620
   00650 Butanoate metabolism
    OCQ_08620
  Lipid metabolism
   00071 Fatty acid degradation
    OCQ_08620
   01040 Biosynthesis of unsaturated fatty acids
    OCQ_08620
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OCQ_08620
   00310 Lysine degradation
    OCQ_08620
   00380 Tryptophan metabolism
    OCQ_08620
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    OCQ_08620
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    OCQ_08620
   00281 Geraniol degradation
    OCQ_08620
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    OCQ_08620
Enzymes [BR:mir01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     OCQ_08620
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     OCQ_08620
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     OCQ_08620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
850206..852350
Genome map
AA seq 714 aa AA seqDB search
MAENTIAWDEDADGIVTLTLDDPTGSANVMNEHYSESMHNAVERLAAEKDSITGVVITSA
KKTFFAGGDLKGMINLGPENAGEAFDTVESVKRDLRALETLGKPVVAAINGAALGGGLEI
ALACHHRIAADVKGSVLGLPEVTLGLLPGGGGVTRTVRMFGIQKAFMEVLSQGTRFKPAK
AKEIGLVDELVGSVDELVPAAKAWIKANPDSHEQPWDKKGYKMPGGTPSSPALAGILPSF
PALLKKQLKGAPMPAPRAILDAAVEGAQVDFDTASRIESRYFTQLVTGQVAKNMIQAFFF
DLQHINGGGSRPDGIEPVKINKIGVLGAGMMGAGIAYVSAKAGFDVVLKDVDIEAAQKGK
GYSEKLEAKALQRGKTTEEKSKALLDRITPTADPAELAGVDFVIEAVFENQELKHKVFQE
IEDIVEPNALLGSNTSTLPITGLATGVKRQEDFIGIHFFSPVDKMPLVEIIKGEKTSDEA
LARVFDYTLAIGKTPIVVNDSRGFFTSRVIGTFVNEALAMLGEGVAPASIEHAGSQAGYP
APPLQLSDELNLELMHKIAAATRKGVEDAGGTYEPHPAEAVVDKMIEIGRPSRLKGAGFY
EYVDGKRTRLWPGLQETFKSGSAEIPLQDMIDRMLFAEALETQKCLDEGVLTSTADANIG
SIMGIGFPPYTGGSAQFIVGYSGAGGTGKDAFVARAKELAAKYGERFLPPKSLS
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaacaccattgcgtgggatgaggacgccgacggcatcgtcaccctgacgctt
gacgaccccaccgggtcggccaacgtgatgaacgagcactacagcgagtccatgcacaac
gctgtggaacgccttgccgccgagaaggattcgatcaccggcgtggtgatcaccagcgcg
aagaagaccttcttcgccggtggtgacctgaagggcatgatcaacctcggccccgagaac
gccggcgaggcgttcgacaccgtcgagtcggtcaagcgcgacctgcgtgcgctggagacc
ctgggcaagccggtggtggccgccatcaacggcgccgcactgggcggcggcctggagatc
gcgctggcctgccaccaccggatcgccgccgacgtcaagggcagcgtcctcggtctgccc
gaggtgacgctgggcctgctgccgggcggcggcggggtgacccgcaccgtgcggatgttc
ggcatccagaaggcattcatggaggtgttgagccagggcacccgcttcaagccggccaag
gccaaggagatcggcctggtcgacgagctcgtcggctcggtcgacgaactggtgcccgcc
gccaaggcgtggatcaaggccaaccccgattcgcacgaacagccctgggacaaaaagggt
tacaagatgcccggcggcaccccgtccagccccgcgctggccggcatcctgccgtcgttc
ccggcgctgctcaagaagcaactcaagggcgccccgatgccggcgccgcgggccatcctg
gacgcggccgtcgagggcgcgcaggtggacttcgacacggccagccgcatcgaaagccgt
tacttcacccagctggtcaccggccaggtcgccaagaacatgatccaggcgttcttcttc
gacctgcagcacatcaacggcggcggttcgcgccccgacggcatcgagccggtcaagatc
aacaagatcggtgtgctgggcgcgggcatgatgggcgccggcatcgcctacgtgtcggcc
aaggccggcttcgacgtggtgctcaaggacgtcgacatcgaggccgcccagaagggcaag
ggttactcggaaaagcttgaggccaaggcacttcagcgtggcaagaccaccgaggagaag
agcaaggcgctgctggaccgcatcacgccgactgccgaccccgccgagctggcgggcgtc
gacttcgtgatcgaggcggtgttcgagaaccaggaactcaagcacaaggtgttccaggag
atcgaggacatcgtcgaacccaacgcgctgctcgggtcgaacacctcaaccctgccgatc
accggtctggcgaccggcgtcaagcggcaggaggacttcatcggaatccacttcttctcg
ccggtcgacaagatgccgctggtggaaatcatcaagggcgagaagacttccgacgaggcc
ctggcccgggtgttcgactacacgctggcgatcggcaagacgccgatcgtggtcaacgac
agccgcgggtttttcaccagccgcgtgatcggcacgttcgtgaacgaggcgctggcgatg
ctcggcgagggcgtggccccggccagcatcgagcacgccggttcgcaggccggctacccg
gcgccgccgctgcagctgtccgacgagctcaacctggagctgatgcacaagatcgccgcg
gccacccgcaagggcgtcgaggacgcgggcggcacctacgagccgcacccggccgaggcc
gtcgtcgacaagatgatcgaaatcggacggcccagccgcttgaagggcgccggcttctac
gagtacgtggacggcaagcggacccgcctgtggcccggcctgcaggagacgttcaagtcg
ggcagcgcggagattccgttgcaggacatgatcgatcgcatgctgttcgccgaggcgctc
gagacgcagaagtgtctggacgagggcgtgctgacctcgaccgccgacgccaacatcggc
tcgatcatgggcatcggcttcccgccgtacaccggtggtagcgcacagttcatcgtcggt
tactccggtgccggcggcacgggcaaggatgcgttcgtggcccgcgccaaggaactggcg
gccaagtacggcgagcggttcctgccgccgaagtcactgagttaa

DBGET integrated database retrieval system