KEGG   Mycobacterium intracellulare MOTT-64: OCQ_09850Help
Entry
OCQ_09850         CDS       T01755                                 

Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mir  Mycobacterium intracellulare MOTT-64
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mir00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    OCQ_09850
   00052 Galactose metabolism
    OCQ_09850
   00500 Starch and sucrose metabolism
    OCQ_09850
   00520 Amino sugar and nucleotide sugar metabolism
    OCQ_09850
Enzymes [BR:mir01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     OCQ_09850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
977030..977902
Genome map
AA seq 290 aa AA seqDB search
MPAAGLGTRFLPATKTVPKELLPVVDTPGIELVAAEAAEAGAERLVIITSEGKDGVVAHF
VEDLVLESTLEERGKTAMLDKVRRAPRLIKVESVVQSEPLGLGHAIGCVESRLSDDENAI
AVLLPDDLVLPTGVLGTMSKVRAHHGGTVLCAIEVTPEEISAYGVFDVEPVPDDENPDVL
RVKSMVEKPKAEDAPSLFAAAGRYVLDRAIFDALRRTERGAGGEVQLTDGIALLIAEGHP
VHVVVHRGSRHDLGNPGGYLKAAVDFALDRDDYGPDLRQWLVARLGLAEQ
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgccgccggtctcggtacccgcttcttgccggcaaccaaaacggttcccaaggaa
ctgctgccggtggtcgataccccgggcatagagctggtggccgccgaagcggccgaagcc
ggcgccgaacggctggtgatcatcacctccgagggcaaggacggcgtcgtcgcgcatttc
gtcgaagacctcgtactggaaagcacgctggaggagcgcggcaagaccgcgatgctcgac
aaggtccgccgcgcgccgcgactgatcaaggtcgagtccgtcgtgcagagcgaaccgctg
gggctcggccatgcgatcgggtgcgtggaatcgcggctgtccgacgacgagaacgcgatc
gcggtgctgctgcccgacgacctggtgttaccgaccggcgtgctgggcacgatgtcgaag
gtgcgggcccaccacggcggcaccgtgttgtgcgcgatcgaggtcacccccgaagagatc
agcgcgtacggcgttttcgacgtcgagccggtgcccgacgatgagaaccccgacgtgctg
cgggtcaagagcatggtcgagaagcccaaggccgaggacgcgccgtcgctgttcgccgcg
gcgggccgatatgtgctcgaccgcgccatctttgacgcgttgcgccgcaccgagcgcggg
gccggtggcgaagtgcaactcaccgacggcatcgccctgctgatcgcggagggccacccg
gtgcatgtggtcgtgcaccgcggatctcgacacgacttgggaaatcctggcggctacctc
aaggctgcggttgactttgcattggatcgtgacgactacggcccggatttgcggcaatgg
ttggtggcgcgattgggcctggccgagcagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system