KEGG   Mycobacterium intracellulare MOTT-64: OCQ_09850Help
Entry
OCQ_09850         CDS       T01755                                 

Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mir  Mycobacterium intracellulare MOTT-64
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:mir00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mir00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mir00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mir00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
977030..977902
Genome map
AA seq 290 aa AA seqDB search
MPAAGLGTRFLPATKTVPKELLPVVDTPGIELVAAEAAEAGAERLVIITSEGKDGVVAHF
VEDLVLESTLEERGKTAMLDKVRRAPRLIKVESVVQSEPLGLGHAIGCVESRLSDDENAI
AVLLPDDLVLPTGVLGTMSKVRAHHGGTVLCAIEVTPEEISAYGVFDVEPVPDDENPDVL
RVKSMVEKPKAEDAPSLFAAAGRYVLDRAIFDALRRTERGAGGEVQLTDGIALLIAEGHP
VHVVVHRGSRHDLGNPGGYLKAAVDFALDRDDYGPDLRQWLVARLGLAEQ
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgccgccggtctcggtacccgcttcttgccggcaaccaaaacggttcccaaggaa
ctgctgccggtggtcgataccccgggcatagagctggtggccgccgaagcggccgaagcc
ggcgccgaacggctggtgatcatcacctccgagggcaaggacggcgtcgtcgcgcatttc
gtcgaagacctcgtactggaaagcacgctggaggagcgcggcaagaccgcgatgctcgac
aaggtccgccgcgcgccgcgactgatcaaggtcgagtccgtcgtgcagagcgaaccgctg
gggctcggccatgcgatcgggtgcgtggaatcgcggctgtccgacgacgagaacgcgatc
gcggtgctgctgcccgacgacctggtgttaccgaccggcgtgctgggcacgatgtcgaag
gtgcgggcccaccacggcggcaccgtgttgtgcgcgatcgaggtcacccccgaagagatc
agcgcgtacggcgttttcgacgtcgagccggtgcccgacgatgagaaccccgacgtgctg
cgggtcaagagcatggtcgagaagcccaaggccgaggacgcgccgtcgctgttcgccgcg
gcgggccgatatgtgctcgaccgcgccatctttgacgcgttgcgccgcaccgagcgcggg
gccggtggcgaagtgcaactcaccgacggcatcgccctgctgatcgcggagggccacccg
gtgcatgtggtcgtgcaccgcggatctcgacacgacttgggaaatcctggcggctacctc
aaggctgcggttgactttgcattggatcgtgacgactacggcccggatttgcggcaatgg
ttggtggcgcgattgggcctggccgagcagtag

DBGET integrated database retrieval system