KEGG   Mycobacterium intracellulare MOTT-64: OCQ_12550Help
Entry
OCQ_12550         CDS       T01755                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mir  Mycobacterium intracellulare MOTT-64
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:mir00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    OCQ_12550
  Amino acid metabolism
   00300 Lysine biosynthesis
    OCQ_12550
Enzymes [BR:mir01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     OCQ_12550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1271603..1272790
Genome map
AA seq 395 aa AA seqDB search
MLMVATRCARLRRACDRHWVLMVATRCARLRRACDRHYPETVLDLRGDPIALTAALVDIP
SESRNEARLADEVEAALRAQTSGFEVVRNGNAVLARTRHQRPSRVLLAGHLDTVPVAGNL
PSRHEGGELHGCGTADMKSGDAVFLHLAATVAEPVHDLTVVMYDCEEIDAAANGLGRIER
ELPDWLAADVAILGEPTGGYIEAGCQGTLRVVVSAAGTRAHSARSWLGDNAIHKLGAVLE
RLAAYEARSVDIDGCTYREGLSAVRIDGGVAGNVIPDAAAVTVNFRFAPDRSVPDALQHV
HDVLAGLDVHIEQTDAAAGAMPGLSQPAAKALVEAAGGNVRAKYGWTDVARFAALGIPAV
NFGPGDPNLAHRRDERVAVANITAAVDMLRRYLGG
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
gtgttgatggtggcgacccgctgcgcccggctccgccgcgcttgcgatcgccactgggtg
ttgatggtggcgacccgctgcgcccggctccgccgcgcttgcgatcgccactaccctgag
accgtgctggacttacgcggggatccgatcgcgctgaccgcggcgctggtcgacatcccc
agcgaatcgaggaacgaggcgcgcctggccgacgaggtcgaggcagcgctgcgcgcgcag
acctccggcttcgaggtcgtccgcaacggcaacgccgtgttggcgcgaacccgacaccag
cggccgtcgcgggtgctgctggccggccacctggacaccgtcccggtggccggaaacctg
cccagccgtcacgagggcggcgagctgcacggctgcggcaccgccgacatgaaatccggg
gacgccgtgttcctccatctcgccgccaccgtcgccgaacccgtgcacgatctgacggtg
gtgatgtacgactgcgaggaaatcgacgcggcggcaaacggtttgggccgcatcgaacgg
gaactgccggactggctggccgccgacgtggccatcctgggcgaaccgacgggcggctac
atcgaagccggttgccagggcaccctgcgcgtggtcgtcagcgccgccgggacccgcgcc
cactcggcgcgatcctggttgggggacaacgctattcacaaactgggtgccgtgctcgaa
cggctggccgcgtacgaggcacgcagcgtggacatcgatggctgcacgtaccgcgagggc
ttgtcggccgtgcgcatcgacggcggggtggcgggcaacgtcattcccgatgctgccgcg
gtgacggtcaacttccgctttgccccggaccggtcggtgcccgacgcgctgcaacacgtg
cacgacgtgctcgccggactggacgtgcacatcgaacagaccgacgccgcggccggggcg
atgcccgggctgtcccagcccgccgccaaggcgttggtcgaggcggcgggcggtaacgtg
cgggccaagtacggctggaccgacgtcgcgcggttcgccgcgctgggtataccggcggtc
aacttcggccccggcgacccgaatttggcgcaccggcgcgacgaacgcgtggcggtcgcc
aacatcaccgcggcggtggacatgctgcgccgctacctgggcggctag

  All links  
No link information was found.   
DBGET integrated database retrieval system