KEGG   Mycobacterium intracellulare MOTT-64: OCQ_12590Help
Entry
OCQ_12590         CDS       T01755                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mir  Mycobacterium intracellulare MOTT-64
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mir00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1277564..1278412
Genome map
AA seq 282 aa AA seqDB search
MSADRALIMAIVNRTPDSFYDRGATFSDEAARAAVHRAVADGADVIDVGGVKAGPGQEVD
ADTEIARLVPFIEWLRDAYPDHVISADTWRSEVAKVACAAGADLINDTWAGVDPALPEVA
AEFGAGLVCSHTGNAQPRTRPFRVNYGTATRGVVDDVIAQVTAAAERAVACGVARDRVLI
DPTHDFGKNTFHGLLLLRHVGDLVDTGWPVLMALSNKDFVGETLGVELTERLEGTLAATA
LAAAAGARMFRVHEVAATRRVLEMVASIQGTRPPTRTVRGLA
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagccgatcgcgcgctgatcatggcgatcgtcaaccgcaccccggactcgttctac
gacaggggcgcgaccttcagcgacgaggccgcccgggcggccgtgcaccgggccgtggcc
gacggcgccgacgtcatcgacgtgggcggcgtcaaggccggcccgggccaagaggtcgac
gccgacaccgagatcgcccggctggtgccgttcatcgaatggttgcgcgacgcctatccc
gaccacgtgatcagcgccgatacctggcgctccgaggtcgccaaggtggcctgcgcggcc
ggggcggacctgatcaacgacacctgggccggcgtcgaccccgccctaccggaggtggcc
gcggagttcggggcgggtctggtctgttcgcacaccggcaacgcgcagccgcgcacgcgc
ccgttccgggtgaactacggaaccgccacgcgcggcgtcgtcgacgacgtgatcgcccag
gtcaccgccgccgccgagcgggcggtcgcgtgcggggtggcgcgcgaccgagtactgatc
gacccgacccacgacttcggcaagaacaccttccacgggctgctgctgttgcggcacgtc
ggcgatctcgtcgataccgggtggccggtgctgatggctttgagtaacaaggacttcgtc
ggggagactctgggtgtggaattgacggagcggctcgagggaacgttggcggccaccgcg
ctggccgcggccgccggtgcgcggatgtttcgcgtgcacgaggtcgccgccacccgccgg
gtgctggaaatggtggcgtcgatccaggggacgcgcccgccgacccgcacggtgaggggg
ctcgcatga

DBGET integrated database retrieval system