KEGG   Mycobacterium intracellulare MOTT-64: OCQ_15550Help
Entry
OCQ_15550         CDS       T01755                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
mir  Mycobacterium intracellulare MOTT-64
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mir01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mir00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1621925..1623028
Genome map
AA seq 367 aa AA seqDB search
MTPQRDAIRNARSLVVKVGTNALTTEAGVFDAGRLAGLADAIETRMKAGTDVVIVSSGAI
AAGIEPLGLSRRPRDLATKQAAASVGQVALVNSWSAAFARYGRTVGQVLLSAHDISMRAQ
HTNAQRTLDRLRALHAVAIVNENDTVATNEIRFGDNDRLSALVAHLVGAEALVLLSDIDG
LYDSDPRKTEGARFIPEVSGSADLVGVIAGPGSDLGTGGMTSKMSSALLAADAGVPVLLA
AASDASTALTDASVGTVFAARPARMSARRFWVRYAAEAAGALTLDEGAVRAVVGQRRSLL
PAGITAVSGRFFGGDVVELRGPDAAMVARGVVAYDATELLTMMGRSTSELPGELRRPAVH
ADDLVAV
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaccccgcagcgcgacgccatccggaacgcgcgcagcctggtggtcaaggtgggcacc
aacgcgttgaccaccgaagccggcgtattcgacgccggccggctggccggtctcgccgac
gcgatcgagacgcggatgaaggcgggcaccgacgtcgtcatcgtgtcctcgggtgccatc
gccgccggcatcgaacctctcggattgtcccgtcgcccacgggatttggcgacgaagcag
gccgcggccagcgtcggtcaggtcgcgctggtgaattcgtggagtgccgcgtttgcccgg
tacggccgcacggtcgggcaggtgctgctgagcgcgcacgacatttcgatgcgcgcccag
cacaccaacgctcagcgcaccctggatcggctgcgggccctgcatgcggtggccatcgtc
aacgagaacgacacggtggccaccaacgagatccggttcggcgacaacgaccggctttcg
gcgctggtggcgcacctggtcggcgccgaggcgctggtgttgttgtccgacatcgacggg
ctgtacgactccgatccacgcaaaaccgaaggcgcccggttcatcccggaggtatcgggt
tcggcggatctggtcggtgtgatcgccgggcccggcagtgatttgggcaccggcggcatg
acctcgaagatgtcgtcggcgctgctggccgccgacgccggcgtcccggtgctgctggcc
gcggcgtccgatgcctcgaccgcgctcaccgacgcgtcggtcggcactgtgttcgccgcg
cggccggcccggatgtcggcgcggcggttctgggtgcgttacgccgccgaggccgccggc
gcgctgaccctcgacgagggggcggtgcgcgcggtcgtcgggcagcgccgctcgctgctg
cccgcggggatcaccgcggtgtccggccggttcttcggcggcgacgtcgtcgaattgcgc
gggccggacgcggcgatggtggcccgtggcgtggtcgcctacgacgcgacggaactgctc
accatgatgggccgctccaccagcgagctgcccggcgagctgcgccggcccgcggtgcac
gccgacgatctggtggcggtgtag

DBGET integrated database retrieval system