KEGG   Mycobacterium intracellulare MOTT-64: OCQ_23280Help
Entry
OCQ_23280         CDS       T01755                                 

Definition
hypothetical protein
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
mir  Mycobacterium intracellulare MOTT-64
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:mir00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2478404..2478973
Genome map
AA seq 189 aa AA seqDB search
MEPVRALIIVDVQNDFCEGGAVPVAGGAAVAPAINAYLSSAPGYRHVVATQDFHIDPGGH
FSDRPDYSSTWPPHCVAGSAGAEFRPDLDTARIDAVFRKGAYSAGYSGFEGADENGTPLL
EWLRQRGIDDVDVAGIATDHCVRRTAEDAARAGLKTRVLVDLTAATTADAAAQALAELES
VGVELVGGS
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
gtggagcccgtgcgagcgttgatcatcgtcgacgtgcaaaacgatttctgcgagggcggc
gccgtgccggtggccggcggcgccgcggtggcgcccgccatcaacgcctacctgtctagc
gcgccgggctatcgccacgtggtggccacccaggacttccacatcgacccgggcgggcat
ttctccgaccggccggactattcctcgacctggccgccgcactgcgtcgccggaagcgcg
ggcgcggaatttcggcccgacttggacaccgcgcgcatcgatgccgtctttcgcaaaggc
gcgtactccgcggggtacagcgggttcgaaggtgccgacgagaacgggacccccctcctg
gagtggttgcggcagcgcggcattgacgacgtcgacgtggccggcatcgccaccgaccat
tgcgtccggcggaccgccgaggacgcggcgcgggcgggcctgaagacccgggtgctcgtc
gacctgaccgcggccaccacagcggatgcggccgcccaggcgctggcggaattggaatcc
gtcggcgtcgaattggtggggggatcgtaa

DBGET integrated database retrieval system