KEGG   Mycobacterium intracellulare MOTT-64: OCQ_24040Help
Entry
OCQ_24040         CDS       T01755                                 

Definition
putative terpene synthesis protein
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
mir  Mycobacterium intracellulare MOTT-64
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mir00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    OCQ_24040
Enzymes [BR:mir01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     OCQ_24040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2548228..2548671)
Genome map
AA seq 147 aa AA seqDB search
MSKSVATKNDNEKIVVDFIHAAYGESMDIDAMTALMAEDFVWQLHVPLSPVVRGRDAARA
ELEKHNTLSTGMVEGSEIRTIVSDGDTVVVERVDVNSMNGVAVTFYVTAIFEVRDGAIAH
WREYWDTAHVAQQLGIDPALMFAPLTN
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaaagtgttgcgaccaaaaacgacaacgagaagatcgtggtcgactttatacat
gccgcttacggcgagagcatggacatcgacgcgatgaccgcgctcatggccgaggacttc
gtgtggcaactccacgttccgctgtccccggtcgtgcggggacgcgacgcggcgcgcgca
gaactcgagaagcacaacacgctgtcgaccggcatggtcgaggggagcgagatccgcacg
atcgtgtccgacggcgacaccgtcgtcgtcgaacgagtcgacgtgaactctatgaatggc
gtggccgtcacgttttatgtcacagccattttcgaggttcgcgacggtgcgatcgctcat
tggcgagagtattgggacaccgcccacgtcgcgcagcaactcggcatcgatcccgcgctg
atgttcgccccgctgacgaattag

DBGET integrated database retrieval system