KEGG   Mycobacterium paraintracellulare: OCQ_24720Help
Entry
OCQ_24720         CDS       T01755                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
mir  Mycobacterium paraintracellulare
Pathway
mir00630  Glyoxylate and dicarboxylate metabolism
mir01100  Metabolic pathways
mir01110  Biosynthesis of secondary metabolites
mir01120  Microbial metabolism in diverse environments
mir01200  Carbon metabolism
Module
mir_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mir00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    OCQ_24720
Enzymes [BR:mir01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     OCQ_24720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AFC53984
UniProt: A0A1X2KJD1
Position
complement(2612622..2614910)
Genome map
AA seq 762 aa AA seqDB search
MAIIDKDTQVRPSFDDEVAATQQYFDDPRFSRITRLYTARQVAEQRGTIPTDYTVARNAA
AAFYERLRELFAQKKSITTFGPYSPGQAVAMKRMGIEGIYLGGWATSAKGSTTEDPGPDL
ASYPLSQVPDDAAVLVRALLTADRNQQYQRLQMSEKQRAAAPVYDYRPFIIADADTGHGG
DPHVRNLIRRFVEVGVPGYHIEDQRPGTKKCGHQGGKVLVPSDEQIKRLNTARFQLDIMK
VPGIIVARTDAEAANLLDSRADERDQPFLLGATNLKIPSYKSCFLALVRRFYELGVKDLN
GHLLYALPEGEYAEATAWLERQGIQGLVSDAVNAWREDGQQSIDDLFDQVESRFVAAWED
DAGLMTYGEAVADVLAFAASEGEPADMSAEEWREFAATASLYSARAKAKELGVDPGWDCE
LSKTPEGYYQIRGGIPYAIAKSLAAAPFADLLWMETKTADLDDARQFADAIHAKFPDQML
AYNLSPSFNWDTTGMTDEQMKQFPEELGKMGFVFNFITYGGHQIDGVAAEEFATSLQQDG
MLALARLQRKMRLVESPYRTPQTLVGGPRSDAALTASSGRTATTKSMGEGSTQHQHLVQT
EVPKKLLEEWLAMWSENYDLGEKLRVQLRPRRAGSDVLELGIYGNDDEQLANVVVDPIKD
RHGRSILQVRDQNTFAEKLRQKRLMTLIHLWLVHRFKADGVIYVTPTEDNLYQTSKMKSH
GIFSEVYQEVGEIIVAEVNQPRIAELLKPDRVALRKLITKEG
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcatcgacaaggacacacaagtccggccatcgttcgacgacgaggtcgctgcc
acgcagcaatacttcgacgatccgcgcttttcccggatcacccgcctgtacacggcccgc
caggtagccgagcagcgcggcaccatcccgaccgactacaccgtggcacgaaacgcggcg
gcggccttctacgagcggttgcgcgagctgttcgcccagaagaagagcatcacgacgttc
ggcccgtactcgcccggccaggcggtcgcgatgaagcggatgggcatcgaggggatctat
ctgggcggctgggccacctcggccaaggggtccaccaccgaagatcccggacccgacctc
gccagctacccgctaagccaggtgcccgacgacgccgcggtgctggtgcgcgccctgctg
accgccgaccgcaaccagcaataccagcgcctgcagatgagcgaaaagcagcgcgccgcg
gccccggtctacgactaccggccgttcatcatcgccgacgctgataccggccacggcggt
gacccgcacgtgcgcaacctgatccgccggttcgtcgaggtcggcgtgcccggctaccac
atcgaggaccagcgccccggcaccaagaagtgcggccatcagggcggcaaggtgttagtg
ccgtccgacgaacagatcaaacggctcaacaccgcgcgcttccagctcgacatcatgaag
gtgccgggcatcatcgtcgcgcgcaccgacgccgaggccgccaacctgctggacagccgg
gccgacgagcgtgaccagccgttcctgctcggagccaccaacctcaagatcccgtcgtac
aagtcgtgcttcctggcgttggtgcgtcgcttctacgagctgggcgtcaaagacctcaac
ggccacctgctgtacgcgctgcccgaaggggagtacgccgaggccacagcttggcttgag
cgccaagggatccagggcctggtctccgacgccgtcaacgcctggcgcgaggacggtcaa
cagtcgatcgacgacctgttcgaccaagtcgagtcgcggttcgtggcggcctgggaggac
gacgccggcctgatgacctacggcgaggccgtcgccgatgtgctcgcgttcgccgccagc
gagggcgaaccggccgatatgagcgccgaggagtggcgagagttcgccgcgaccgcctcg
ctctactcggccagggccaaggcgaaggagttgggcgtcgaccccggttgggactgcgaa
ctctcgaagacgcccgagggctactaccagatccgcggcggcatcccgtacgccatcgcc
aaatcgctggcggccgcgccgttcgccgacctcttgtggatggagaccaagaccgccgac
ctggacgacgcccggcagttcgccgacgccatccacgccaagttccccgaccagatgctg
gcctacaacctgtccccgtcgttcaactgggacaccaccggcatgaccgacgagcagatg
aagcagttccccgaggaactgggcaagatgggtttcgtcttcaacttcatcacctacggc
ggacaccagatcgacggcgtcgccgccgaggagttcgccacctcgctgcaacaggacggc
atgctggcgctggcccgcctgcagcgcaagatgcgcctggtcgaatctccttaccgcaca
ccgcaaaccctcgtcgggggaccgcgcagtgacgccgcgctcacggcctcctcgggccgc
accgccaccaccaagtcgatgggcgaaggctcgacccagcaccagcacctggtgcagacc
gaggtgccgaagaagctgctcgaggagtggctggcgatgtggagcgagaactacgacctc
ggcgagaaactgcgggtgcaactgcggccccgccgggccggctcggacgtgctcgaactc
ggcatctacgggaacgacgacgagcagctggccaacgtggtcgtcgacccgatcaaggac
cggcacggccgcagcatccttcaggtgcgcgaccagaacaccttcgcggagaagctccgg
cagaagcggctgatgaccttgatccacctctggctggtgcaccgcttcaaggccgacggg
gtgatctatgtgacgccgaccgaggacaacctgtatcagacctcgaagatgaaatcccac
ggcatcttcagcgaggtctaccaggaggtcggcgagatcatcgtcgccgaggtgaatcag
ccccgcatcgccgaactgcttaagcccgaccgcgtggcgctgcgcaagctgatcaccaag
gaggggtag

DBGET integrated database retrieval system