KEGG   Mycobacterium paraintracellulare: OCQ_25670Help
Entry
OCQ_25670         CDS       T01755                                 

Definition
(GenBank) malate synthase G
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
mir  Mycobacterium paraintracellulare
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mir00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    OCQ_25670
   00630 Glyoxylate and dicarboxylate metabolism
    OCQ_25670
Enzymes [BR:mir01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     OCQ_25670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2702457..2704625
Genome map
AA seq 722 aa AA seqDB search
MRVARVLYDFVNEEALPGTDIDPDSFWAGVDKVVTDLTPKNQDLLRRRDELQAQIDKWHR
QRVIEPLDIDAYREFLTEIGYLLPEPADFTITTSGVDDEITTTAGPQLVVPVLNARFALN
AANARWGSLYDALYGTDVISEDDGAEKGSSYNKVRGDKVIAYARKFLDEAVPLESGSWAD
ATGLSVEDGRLKVATADGSAGLADPDKFAGYTGELGSPSWSVLLVNHGLHIEILIDPDSP
IGKTDAAGIKDVILESAVTTIMDFEDSVAAVDADDKVLGYRNWLGLNKGDLSEDVDKGGK
TFTRVLNQDRTYSTPDGEGELTLPGRSLLFVRNVGHLMTNDAIIDAEGHEVFEGIMDALF
TGLTAIHGLKTSEANGPLANSRTGSIYIVKPKMHGPDEVAFTCELFSRVEDVLGLPQGTL
KVGIMDEERRTTVNLKACIKAAADRVVFINTGFLDRTGDEIHTSMEAGPMIRKGAMKGTT
WIKAYEDANVDIGLAAGFKGKAQIGKGMWAMTELMADMVEQKIGQPKAGATTAWVPSPTA
ATLHAMHYHYVDVGAVQEELAGKKRTNIDELLTIPLAKELAWAPEEIREEVDNNCQSILG
YVVRWVAQGVGCSKVPDIHDVALMEDRATLRISSQLLANWLRHGVITEEDVRASLERMAP
LVDEQNAKDAAYLPMAPNFDDSLAFLAAQDLILTGTQQPNGYTEPILHRRRREAKARAAQ
SN
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcgtcgcccgggtgctttacgacttcgtgaacgaagaggccttgcccggcaccgat
atcgacccggacagcttctgggccggcgtggacaaggtcgtcaccgacctcaccccgaag
aaccaggatctgctgcgccggcgtgacgagctgcaggcccagatcgacaagtggcaccgg
cagcgggtcatcgagccgctcgacatcgacgcctatcgcgagttcctcaccgaaatcggt
tacctgctgcccgaacccgcggatttcacgatcaccacctcgggcgtcgacgacgagatc
accacgaccgcgggcccccagctcgtggtgccggtgctcaacgcccggttcgcgctgaac
gccgccaacgcccggtggggttcgctctacgacgccctgtacggcaccgacgtcatctcg
gaggacgacggcgccgaaaaggggtcgagctacaacaaggtgcgtggcgacaaggtcatc
gcctacgcgcgcaaattcctggacgaggccgtgccgctggaatccggctcgtgggccgac
gcgaccggtctgtccgtcgaggacggccgcctgaaggtcgcgaccgccgacggttccgcc
ggcctggccgacccggacaagttcgccggctacaccggcgagctcggctcccccagctgg
tcggtgctgctggtcaaccacggcctgcacatcgagatcctcatcgatccggactcgccg
atcggcaagaccgacgccgccggcatcaaggacgtgatcctggaatcggccgtgaccacg
atcatggacttcgaggactcggtggccgccgtcgacgccgacgacaaggtgctcggctac
cgcaactggctcggcctgaacaagggcgacctgtccgaggacgtcgacaagggcggcaag
accttcacccgggtgctcaaccaggaccgcacctactccacgcccgacggcgagggcgag
ctgaccctgccgggccgcagcctgctgttcgtccgcaacgtcggccacctgatgaccaac
gacgcgattatcgacgcggagggtcacgaggtgttcgagggcatcatggatgcgctgttc
accgggctgaccgcgattcacgggctcaagacgagtgaggcgaacgggccgctggccaac
agccgcaccgggtccatctacatcgtcaagcccaagatgcacgggcccgacgaggtcgcg
ttcacctgcgagctgttcagccgggtcgaagacgtcctcgggctgccgcagggcaccctc
aaggtcggcatcatggacgaggagcggcgcaccaccgtcaacctcaaggcctgcatcaag
gccgcggccgaccgggtggtgttcatcaacaccggcttcctcgaccgcaccggcgacgag
atccacacctcgatggaggcgggtccgatgatccgcaagggcgcgatgaagggcaccacc
tggatcaaggcctacgaggacgccaacgtcgacatcggcctggccgccgggttcaagggc
aaggcgcagatcggcaagggcatgtgggcgatgaccgaactgatggccgacatggtcgag
cagaagatcggccagcccaaggccggagccaccaccgcgtgggtgccctcgccgacggcg
gccaccctgcacgcgatgcactaccactacgtcgacgtgggcgccgtgcaggaggagctg
gcgggcaagaagcgcaccaacatcgacgagttgctgaccatcccgctggccaaggaactg
gcctgggctcccgaggagatccgcgaggaggtcgacaacaactgccagtccatcctcggc
tacgtggtgcgctgggtcgcccagggcgtcggctgctcgaaggtgcccgacatccacgac
gtggcgctcatggaagaccgtgcgacactgcggatttcgagtcagctgctggcgaactgg
ctgcgccacggtgtgatcaccgaggaggacgtgcgggccagcctcgagcggatggccccg
ctggtggacgagcaaaacgccaaggatgcggcgtatttgccgatggcgcccaacttcgac
gacagcctggcgttcctggcggcgcaggacctcatcctgaccggaacgcagcagcccaac
ggctacaccgagccgatcctgcaccgccgtcggcgcgaggccaaggcgcgcgccgcgcag
tcgaattga

DBGET integrated database retrieval system