KEGG   Mycobacterium intracellulare MOTT-64: OCQ_25670Help
Entry
OCQ_25670         CDS       T01755                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
mir  Mycobacterium intracellulare MOTT-64
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mir00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OCQ_25670
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    OCQ_25670
   00630 Glyoxylate and dicarboxylate metabolism
    OCQ_25670
Enzymes [BR:mir01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     OCQ_25670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2702457..2704625
Genome map
AA seq 722 aa AA seqDB search
MRVARVLYDFVNEEALPGTDIDPDSFWAGVDKVVTDLTPKNQDLLRRRDELQAQIDKWHR
QRVIEPLDIDAYREFLTEIGYLLPEPADFTITTSGVDDEITTTAGPQLVVPVLNARFALN
AANARWGSLYDALYGTDVISEDDGAEKGSSYNKVRGDKVIAYARKFLDEAVPLESGSWAD
ATGLSVEDGRLKVATADGSAGLADPDKFAGYTGELGSPSWSVLLVNHGLHIEILIDPDSP
IGKTDAAGIKDVILESAVTTIMDFEDSVAAVDADDKVLGYRNWLGLNKGDLSEDVDKGGK
TFTRVLNQDRTYSTPDGEGELTLPGRSLLFVRNVGHLMTNDAIIDAEGHEVFEGIMDALF
TGLTAIHGLKTSEANGPLANSRTGSIYIVKPKMHGPDEVAFTCELFSRVEDVLGLPQGTL
KVGIMDEERRTTVNLKACIKAAADRVVFINTGFLDRTGDEIHTSMEAGPMIRKGAMKGTT
WIKAYEDANVDIGLAAGFKGKAQIGKGMWAMTELMADMVEQKIGQPKAGATTAWVPSPTA
ATLHAMHYHYVDVGAVQEELAGKKRTNIDELLTIPLAKELAWAPEEIREEVDNNCQSILG
YVVRWVAQGVGCSKVPDIHDVALMEDRATLRISSQLLANWLRHGVITEEDVRASLERMAP
LVDEQNAKDAAYLPMAPNFDDSLAFLAAQDLILTGTQQPNGYTEPILHRRRREAKARAAQ
SN
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcgtcgcccgggtgctttacgacttcgtgaacgaagaggccttgcccggcaccgat
atcgacccggacagcttctgggccggcgtggacaaggtcgtcaccgacctcaccccgaag
aaccaggatctgctgcgccggcgtgacgagctgcaggcccagatcgacaagtggcaccgg
cagcgggtcatcgagccgctcgacatcgacgcctatcgcgagttcctcaccgaaatcggt
tacctgctgcccgaacccgcggatttcacgatcaccacctcgggcgtcgacgacgagatc
accacgaccgcgggcccccagctcgtggtgccggtgctcaacgcccggttcgcgctgaac
gccgccaacgcccggtggggttcgctctacgacgccctgtacggcaccgacgtcatctcg
gaggacgacggcgccgaaaaggggtcgagctacaacaaggtgcgtggcgacaaggtcatc
gcctacgcgcgcaaattcctggacgaggccgtgccgctggaatccggctcgtgggccgac
gcgaccggtctgtccgtcgaggacggccgcctgaaggtcgcgaccgccgacggttccgcc
ggcctggccgacccggacaagttcgccggctacaccggcgagctcggctcccccagctgg
tcggtgctgctggtcaaccacggcctgcacatcgagatcctcatcgatccggactcgccg
atcggcaagaccgacgccgccggcatcaaggacgtgatcctggaatcggccgtgaccacg
atcatggacttcgaggactcggtggccgccgtcgacgccgacgacaaggtgctcggctac
cgcaactggctcggcctgaacaagggcgacctgtccgaggacgtcgacaagggcggcaag
accttcacccgggtgctcaaccaggaccgcacctactccacgcccgacggcgagggcgag
ctgaccctgccgggccgcagcctgctgttcgtccgcaacgtcggccacctgatgaccaac
gacgcgattatcgacgcggagggtcacgaggtgttcgagggcatcatggatgcgctgttc
accgggctgaccgcgattcacgggctcaagacgagtgaggcgaacgggccgctggccaac
agccgcaccgggtccatctacatcgtcaagcccaagatgcacgggcccgacgaggtcgcg
ttcacctgcgagctgttcagccgggtcgaagacgtcctcgggctgccgcagggcaccctc
aaggtcggcatcatggacgaggagcggcgcaccaccgtcaacctcaaggcctgcatcaag
gccgcggccgaccgggtggtgttcatcaacaccggcttcctcgaccgcaccggcgacgag
atccacacctcgatggaggcgggtccgatgatccgcaagggcgcgatgaagggcaccacc
tggatcaaggcctacgaggacgccaacgtcgacatcggcctggccgccgggttcaagggc
aaggcgcagatcggcaagggcatgtgggcgatgaccgaactgatggccgacatggtcgag
cagaagatcggccagcccaaggccggagccaccaccgcgtgggtgccctcgccgacggcg
gccaccctgcacgcgatgcactaccactacgtcgacgtgggcgccgtgcaggaggagctg
gcgggcaagaagcgcaccaacatcgacgagttgctgaccatcccgctggccaaggaactg
gcctgggctcccgaggagatccgcgaggaggtcgacaacaactgccagtccatcctcggc
tacgtggtgcgctgggtcgcccagggcgtcggctgctcgaaggtgcccgacatccacgac
gtggcgctcatggaagaccgtgcgacactgcggatttcgagtcagctgctggcgaactgg
ctgcgccacggtgtgatcaccgaggaggacgtgcgggccagcctcgagcggatggccccg
ctggtggacgagcaaaacgccaaggatgcggcgtatttgccgatggcgcccaacttcgac
gacagcctggcgttcctggcggcgcaggacctcatcctgaccggaacgcagcagcccaac
ggctacaccgagccgatcctgcaccgccgtcggcgcgaggccaaggcgcgcgccgcgcag
tcgaattga

DBGET integrated database retrieval system