KEGG   Mycobacterium intracellulare MOTT-64: OCQ_26220Help
Entry
OCQ_26220         CDS       T01755                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mir  Mycobacterium intracellulare MOTT-64
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mir00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    OCQ_26220
Enzymes [BR:mir01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     OCQ_26220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2764280..2766463
Genome map
AA seq 727 aa AA seqDB search
MTELAPSLIELARRYGIATEYEDWSGRRVRVSEATLKAVLAALGVAADDEQERNLALTAK
LRSHWARRLPATIVGRTGEQIRFWAHVTHGAPAEVWLTLEDGTVRGDVAQVDNFTPPFDL
DGRWVGEASFLLPTDLPLGYHRVHLRSGDSETSTALIVTPDWLGLPERLGNRRAWGLAVQ
LYSVRSRRSWGVGDLTDLTDLAVWSASRHGADYLLVNPLHAAAPAGPKGRMEPSPYLPTS
RRFVNPIYLRVEAIPEFADLGKRSRVRRLRADVQERAGRVDTIDRDSSWAAKRAALKLLH
EEPRSAGRELSYAAFRDREGRALDDFATWCALAEQYGDDWHCWPESLQHPDASGVADFVE
KHSDTVDFHRWLQWQIDEQLAAAQSQAIRAGMSLGIMGDLAVGVHPNGADTWALQDVMAL
GVTAGAPPDEFNQLGQDWSQPPWRPDRLDEHEYRPFRALIRAVLRHAGGVRIDHIIGLFR
LWWIPRGASPTEGTYVRYDHEAMIGIVALEAHRAGAVVVGEDLGTVEPWVRDYLLLRGLL
GTSILWFELDRDGNGGPLPAERWREYCLSSVTTHDLPPTAGYLAGDHVRLRDSLGLLTRP
VAEELESDRAELAAWLAELRRVGLLDEGEDDPQQVVLALYKYLGRTPSRLLGLALTDAVG
DRRTQNQPGTTDEYPNWRVPLTGPDGRDVLLEDVFTDPRAATLAEAVRAAIAPAASESSE
SVQSAAR
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaactcgcaccgtcgctgatcgaactcgcccggaggtacggcatcgcgacggag
tacgaggactggagcggcaggcgggtgcgggtgtcggaggcgacgctcaaggccgtgctg
gccgcgctcggcgtcgcggccgacgacgaacaggaacgcaacctcgcgctcaccgccaag
ctgcggtcgcactgggcgcggcggctgccggcgaccatcgtcggccgcaccggtgagcag
atccggttttgggcccacgtcacccatggtgctcccgccgaggtgtggttgacgctcgag
gacggcacggtgcgcggcgacgtcgcgcaggtcgacaacttcaccccgccgttcgacctg
gacggacgctgggtcggcgaggccagcttcctgctgcccaccgacctgccgctggggtat
caccgggtgcacctgcggtccggggactccgagaccagcaccgcgctgatcgtgacgccg
gattggctcgggctgccggagcggctcggcaaccgtcgcgcctggggcctggccgttcag
ctctacagcgtgcggtcccggcggtcctggggcgtcggcgatctcaccgatctgaccgac
ctcgcggtgtggtcggcgtcgcgccacggcgccgattaccttctggtcaatccgctgcat
gcggcggcgcctgcgggtccgaagggccggatggagccatcgccgtacctgccgacgtcg
cggcgcttcgtcaatccgatttatcttcgcgtcgaggcgatccccgaattcgccgacctg
ggcaagcgcagccgggtccgccggctgcgcgcggacgtccaggagcgcgccggccgcgtc
gacaccatcgaccgcgacagctcgtgggcggccaaacgggccgccctcaagctgctgcac
gaggaaccgcggtcggcgggccgggagctgtcgtacgcggcgttccgcgaccgggagggc
cgcgcgctcgacgacttcgcgacctggtgcgcgctggccgaacaatacggcgatgactgg
cattgttggcccgaatcgctgcaacatcccgacgcgtccggggtcgcagactttgtcgaa
aaacattccgacacagtcgatttccaccgctggttgcaatggcaaatcgacgagcagctc
gccgcggcccagtcccaggcgatccgggccggaatgtcgttgggcatcatgggcgacctg
gccgtcggcgtgcaccccaacggcgccgacacctgggcgctgcaggatgtgatggcgctg
ggcgtgaccgccggggcgccaccggacgagttcaatcagctcggccaggactggtcgcag
ccgccgtggcggccggaccgactggacgagcacgagtaccggccgtttcgcgcgttgatc
cgcgcggtgctgcggcacgccggcggggtgcgcatcgaccacatcatcgggttgttccgg
ctctggtggatcccgcggggtgcatcacccaccgagggcacctacgtccgctacgaccac
gaagccatgatcggcatcgtcgccctggaggcacaccgggccggcgcggtggtggtgggc
gaggacctcggcacggtcgagccgtgggtgcgcgactacctgttgttgcgggggctgctg
ggcacgtcgatcctctggttcgagctggaccgcgacgggaacggcggaccactgccggcg
gagcgctggcgggagtactgcctgtcctcggtcaccacccacgacctgccgccgacggcc
ggctacctggcgggcgaccatgtgcggctgcgtgactcgctgggattgctgacccggccc
gtcgccgaggagctcgagtccgaccgtgccgagttggcggcgtggctggccgagttgcgc
cgggtggggctgctcgatgaaggcgaagacgacccgcagcaggtcgtcctggcgctgtac
aagtacctgggccggacgccgtcgcggctgctggggctggcgctcaccgacgccgtcggt
gaccgtcgcacccagaaccagcccggcaccacggacgaataccccaactggcgggtcccg
ctgaccggtccggacgggcgcgacgtgctgctcgaagacgtgttcaccgacccccgggcc
gccacgctggccgaggccgtgcgcgccgcgatcgccccggccgcctcggaaagctcggag
agcgttcaaagcgcggcccgctga

DBGET integrated database retrieval system