KEGG   Mycobacterium intracellulare MOTT-64: OCQ_27160Help
Entry
OCQ_27160         CDS       T01755                                 

Definition
hypothetical protein
Orthology
K16051  
3-oxo-5alpha-steroid 4-dehydrogenase [EC:1.3.99.5]
Organism
mir  Mycobacterium intracellulare MOTT-64
Pathway
Steroid degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mir00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    OCQ_27160
Enzymes [BR:mir01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With other acceptors
    1.3.99.5  3-oxo-5alpha-steroid 4-dehydrogenase (acceptor)
     OCQ_27160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2861380..2862855
Genome map
AA seq 491 aa AA seqDB search
MIAESDVTPVAASSITSWDAEADVVIAGYGIAGAAAAVEAARSGADVLVLERTGSWGGAA
SMAGGFIYLGGGTPLQKACGFSDSVDNMAAFLNVAMGPGADEARIADYCAGSVAHFDWLV
GCGVPFKAEFFSEPGWEPMGDQGLMYSGGENSYPFNTIASPAPRGHVPQMQNKKQGEASA
GYMLMKPLVETATAAGARALYDVRVQRLITESDGRVVGICARQYGNDMTIRARRGVVLAT
GSFAYNDAMVARYAPRIAGRPAASIEQHDGQAIRMAQALGADLAHMDATEVAIFVDPQQL
VRGILVNGRGQRYVAEDTYPGRIGQLTLYQQDNVAYLIIDGDAQEAAEASWSPKLMLRPA
TWVADTVADLERDMGLPPGSLQATVAAYNEGAARGEDPLLHKKSEWIKPIGSPVGAIDLR
ESTGGFTLGGLATTLDAEVLHVSGAPIPGLFAAGRCTAGLAAWGYASGVSLGDGSFYGRR
AGRSASLFPRA
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgccgaatctgacgtgacgccggtggcggcgtcgtcgatcacgtcgtgggacgcc
gaggccgacgtcgtcatcgccggctatgggatcgcgggcgccgcggcggcggtggaagcc
gcccggtccggcgccgacgtcctggtgctcgagcgcaccggatcctggggcggcgcggca
tcgatggcgggcggattcatctacctcgggggcggcacgccgctgcaaaaggcttgcggc
ttcagcgattcggtcgacaacatggcggcgttcctcaacgtcgcgatgggccccggcgcc
gacgaggccaggatcgccgactattgcgccggcagcgtcgcccacttcgactggctggtg
ggctgcggcgtcccgttcaaggcggagttcttctccgagccgggctgggagcccatgggc
gaccaggggttgatgtacagcggcggcgaaaactcctatccgttcaacacgatcgcctcc
cccgccccgcgcgggcacgtcccgcagatgcagaacaagaagcagggcgaagcgagtgcg
ggctacatgctgatgaagcccctcgtcgaaacggccaccgccgccggggcgcgggccctc
tacgacgtgcgggtgcagcggctgatcaccgaatccgacggccgggtggtgggcatctgc
gcccgccagtacggcaacgacatgacgatccgggcgcgccgcggggtcgtgctggccacc
ggcagtttcgcctacaacgacgcgatggtggcgcgctacgcgccgcgcatcgcggggcgg
ccggccgcgtcgatcgagcagcacgacgggcaggcgatccggatggcgcaggcgctgggc
gccgacctggcgcacatggacgccaccgaggtcgcgatcttcgtcgacccccagcagctg
gtgcgcggcatcctggtcaacgggcgcggtcagcgctacgtcgccgaggacacctatccg
gggcggatcggccagctcacgctgtaccagcaggacaacgtcgcgtacctgatcatcgac
ggcgacgcgcaggaggcggcggaggcctcgtggtcgccgaagctgatgctgcgcccggcg
acctgggtggccgacaccgtcgcggacctggagcgcgacatgggcctgccgcccggttcg
ctgcaggccaccgtggccgcctacaacgagggcgccgcgcgcggcgaggatccgctgctg
cacaagaagtccgagtggatcaagccgatcggatcgccggtcggcgcgatcgacctgcgg
gaaagcaccggcggcttcaccctgggcgggctggcgaccacgctggacgccgaggtgctg
cacgtcagcggcgcgcccatacccgggctgttcgccgccggccggtgcaccgccggcctg
gccgcgtggggctacgccagcggcgtctcgctcggtgacggcagcttctacggccgccgc
gccgggcgctcggcgagtctttttccgcgggcgtaa

DBGET integrated database retrieval system