KEGG   Mycobacterium intracellulare MOTT-64: OCQ_27500Help
Entry
OCQ_27500         CDS       T01755                                 

Definition
asnB_1 (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mir  Mycobacterium intracellulare MOTT-64
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mir00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2896011..2897750)
Genome map
AA seq 579 aa AA seqDB search
MAAVLTPRGPDSGGAWSQGRVALGHRRLKIIDLTEAGSQPMVDSELGLSIAWNGCIYNYK
ELRSELSGYGYRFFSHSDTEVLIKAYHRWGDDFVSHLFGMFAFAIVERDSGRVLLGRDRL
GIKPLYLTEDNHRVRFASTLPALLAGGGVDTRIDPVALHHYMTFHSVVPAPATILRGVRK
VPPASLVAIEPDGRRTVTTYWAPDFTRHADRADWSERDWEDAVLSTLRLAVKRRLVADVP
VGCLLSGGVDSSLIVGLLAEAGQHGLSTFSIGFESAGGVKGDEFQYSDIVAKRFETDHHQ
IRIETERMLPALDGAIGAMSEPMVSHDCVAFYLLSQEVARHVKVVQSGQGADEVFAGYHW
YPPMGSPAAASLQGAVAEYRGAFFDRDSAELAGLLGPGIMAPGDPSGRFVTEHFAQAGAE
TGVDRALRLDTTVMLIDDPVKRVDNMTMAWGLEGRVPFLDHELVELAATCPPELKIAHEG
KGVLKQAARRVIPSEVIDRPKGYFPVPALTHLEGPYLDMVRDALYAPVAKERGLFRAEAV
DTLLENPNGKLTPLRGNELWQIALLELWLQRHGITGPVA
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgtgctgacgccgaggggcccggacagtggcggcgcctggtcgcagggccgg
gttgccctcggccatcgtcgcctcaagatcatcgacctgaccgaggccggctcgcagccg
atggtcgactccgaactgggcctgtcgatcgcctggaacggctgcatctacaactacaag
gaactgcgcagcgaactcagcgggtacggctaccgcttcttctcgcacagcgacaccgag
gttctgatcaaggcctaccaccgatggggcgacgacttcgtcagccacctgttcggcatg
ttcgccttcgccatcgtcgagcgcgacagcgggcgggtgctgctcgggcgcgaccggctc
ggcatcaaacccctgtacctgaccgaggacaaccaccgggtccgcttcgcctcgaccctg
ccggccctgctggccggcggcggcgtggacacccgcatcgaccccgtcgcgctgcaccac
tacatgaccttccactcggtggtgcccgccccggccaccatcctgcgcggggtgcgcaag
gtgccgcccgcctcgctcgtcgcgatcgagcccgacggcaggcgcaccgtcaccacgtac
tgggcgcccgacttcacccggcacgccgaccgcgcggactggtcggagcgcgactgggaa
gacgccgtgctgtccacgctgcgcctggcggtgaagcgccgcctggtcgccgacgtgccg
gtcggctgcctgctgtccggcggtgtcgactccagcctgatcgtgggcctgctcgccgag
gccggccagcatgggctgtccaccttctcgatcggcttcgagtcggccggcggcgtcaag
ggcgacgagttccagtactccgacatcgtggccaagcgcttcgagaccgaccaccaccag
atccgcatcgagaccgaacggatgctgcccgccctcgacggggccatcggcgcgatgagc
gagccgatggtcagccacgactgcgtcgccttctacctgctcagtcaggaagtcgcgcgc
cacgtgaaggtcgtgcagtccggccagggcgccgacgaggtgttcgccggctatcactgg
tacccgccgatgggctcgccggccgccgcgtcgctgcagggtgcggtcgccgagtaccgc
ggtgccttcttcgaccgtgattcggccgagctggccggcctgctgggcccgggcatcatg
gcgcccggcgaccccagtggccgctttgtcaccgagcacttcgcgcaggccggcgccgag
acgggcgtcgaccgcgcgttgcgcctcgacaccaccgtgatgctcatcgacgacccggtg
aagcgggtcgacaacatgacgatggcgtgggggctggagggccgggttccgttcctcgac
cacgagctggtggaactggccgccacctgcccgccggagttgaagatcgcgcacgaaggc
aagggcgtcctcaaacaggctgcgcggcgggtgattccatcggaggtcatcgaccggccc
aagggctatttcccggttccggcgctgacccatctcgaagggccctacctcgacatggtc
cgcgacgccctctacgcgccggttgccaaggagcgcggcctgtttcgtgccgaagcggtc
gacaccctgctggagaatcccaacggcaagctgaccccgctgcgcggcaacgagctgtgg
cagatcgccctgctcgagctgtggttgcagcgtcacggcatcacggggccggttgcatga

DBGET integrated database retrieval system