KEGG   Mycobacterium intracellulare MOTT-64: OCQ_30540Help
Entry
OCQ_30540         CDS       T01755                                 

Definition
CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
mir  Mycobacterium intracellulare MOTT-64
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:mir00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    OCQ_30540
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    OCQ_30540
Enzymes [BR:mir01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     OCQ_30540
Two-component system [BR:mir02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   OCQ_30540
Bacterial motility proteins [BR:mir02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    OCQ_30540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3244917..3245513
Genome map
AA seq 198 aa AA seqDB search
MVLVASLGGMKALGTVLAGLPGDFAVPVVVAQHRRPTLSGDDPLAQILSRASSLPIRVAE
PGAPADKPGITIVPAGKTATIDADGAWMLAEEAAKASVGDAVLTSSAALVPTVAVILTGR
LADGANGCRAVKRNGGRVLVQDPATAEASSMPAHAIATGCVDFVLPPDRLAAAVLALTTA
PGGAELLTVPVPPWACLN
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtggtgctggtggcgtcgctgggcggcatgaaagccctgggcaccgtgctcgcgggtctg
ccgggtgattttgcggtacccgtcgtcgtcgcccagcatcgccgccccacgctcagcggc
gacgatccgctggcccagattttgtcccgcgcgagctctctgccgattcgagtcgccgag
ccgggggcgccggcggacaaaccgggcatcaccatcgtgcccgccggaaagacggcaacc
atcgatgcggacggcgcctggatgctcgccgaggaagcggccaaggccagcgtcggggac
gccgtcctgaccagctccgccgcgctggtgccgacggtcgccgtgatcctgaccgggcgg
ctggccgacggcgccaacggatgtcgcgcggtcaagcgcaacggcgggcgcgtgctcgtc
caagacccggcgaccgccgaggcgtcgagcatgccggcgcacgcgatcgccaccggctgc
gtggatttcgtgctgccgcccgatcgcctcgcggcggcggtgctcgccctgaccaccgca
cccgggggcgccgaactgctgacggttcccgtgccgccgtgggcatgtcttaactag

DBGET integrated database retrieval system