KEGG   Mycobacterium paraintracellulare: OCQ_30820Help
Entry
OCQ_30820         CDS       T01755                                 

Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mir  Mycobacterium paraintracellulare
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mir00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    OCQ_30820
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OCQ_30820
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    OCQ_30820
Enzymes [BR:mir01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     OCQ_30820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(3274361..3275176)
Genome map
AA seq 271 aa AA seqDB search
MTVKQSEASRLGPIFDVCRDDGRAALIGYLPTGYPDVTTSVHAMVALVESGCDIVEVGVP
YSDPGMDGPTIAKATEAALHGGVRVRDTLAAVEAIGAAGGHAVVMTYWNPVLRYGIDAFA
RDLASAGGYGLITPDLIPDEAGQWLAASEEHRLDRIFLVAPSSTPQRLAMTVEASRGFVY
AASTMGVTGARDVVSNAAPELVGRVKEISDIPVGVGLGVRSGEQAAQIGGYADGVIVGSA
LVSALGDGGLTALRALTEELAAGVRQRAAAS
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcaagcagagcgaggccagcaggctcgggccgatcttcgacgtgtgccgcgac
gacggtcgcgccgcgctgatcggctatctgccgaccgggtacccggatgtgacgacgtcc
gtgcacgcgatggtcgccctggtcgaatccggttgcgacatcgtcgaggtcggggtgccc
tattcggatcccggcatggacggcccgaccatcgccaaggccaccgaggccgcgctgcac
gggggagtgcgcgtccgcgacaccctggccgcggtcgaggcgatcggcgccgccgggggc
cacgccgtggtgatgacctactggaaccccgtgttgcgctacggaattgacgccttcgcc
cgcgacctggcatcggccggcggatacggcctgatcactccggaccttatccccgacgaa
gccgggcagtggttggcggcgtccgaggagcatcggttggaccggatatttctggtggcg
ccctcctcgacgccgcagcgcttggcgatgacggtcgaggcgtcccgcggatttgtctac
gcggcgtcgacgatgggcgtcacgggagcacgcgacgtggtgtccaatgccgcgcccgaa
ttggtgggcagggtcaaggagatatcggacatccccgtcggtgtcgggctgggggtgcgg
tcgggtgagcaagccgcccagatcggcggctacgccgacggtgtcattgtcggttccgcg
ctggtgtcggcgctgggggacgggggtttgaccgcattgcgcgcactcactgaggaactc
gccgccggtgtacgtcaaagggcggccgcgtcgtga

DBGET integrated database retrieval system