KEGG   Mycobacterium paraintracellulare: OCQ_30830Help
Entry
OCQ_30830         CDS       T01755                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mir  Mycobacterium paraintracellulare
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mir00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OCQ_30830
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    OCQ_30830
Enzymes [BR:mir01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     OCQ_30830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(3275173..3276435)
Genome map
AA seq 420 aa AA seqDB search
MMVDLSRPDLPLPSAAIAEPTRHEPDAGGHFGVYGGRYVAEALMAVIEEVTAAYEKERVN
QDFLDTLDYLQAHYAGRPSPLYEAPRLSEQAGTRIFLKREDLNHTGSHKINNVLGQALLA
QRMGKKRVIAETGAGQHGVATATACALLGLECVIYMGAVDTERQALNVARMRLLGATVVS
VQSGSRTLKDAINEAFRDWVTNADNTFYCFGTAAGPHPFPAMVRDFQRIIGLEARAQIQA
QAGRLPDAVLACIGGGSNAIGIFHPFIDDPGVRLIGFEAAGDGVETGRHAATFSGGSPGA
FQGSFSYLLQDEDGQTIESHSISAGLDYPGVGPEHAWLRESGRAEYRPITDSEAMEAFRT
LCRTEGIIPAIESAHAVAGALKVAPELGKAAIIVVNLSGRGDKDVETAAQWFGLLGSSDR
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtgatggtggatctgtcccgcccggaccttccgcttccgagcgcagccatcgccgaaccc
acccgccacgaacccgatgcgggtggccatttcggtgtgtacggcggccgctacgtcgcc
gaggcgttgatggccgtgatcgaagaggtcaccgcggcctacgagaaggagcgcgtcaac
caggatttcctggacacgctggactatctgcaggcgcactacgccgggcggccgtcaccg
ctgtatgaggcgcctcggctgtccgagcaggccggcacccgcatcttcctcaagcgagaa
gacctgaaccacaccggttctcacaagatcaacaacgtgctcggccaggcgctgctcgct
cagcgcatgggcaagaagcgggtgatcgccgagaccggggccggtcagcacggcgtggcg
accgccaccgcgtgcgccctgctcggcctggagtgtgtaatctacatgggggccgttgac
accgaacgccaggcgctcaacgtggcccggatgcgcttgctgggagccacggtcgtctcg
gtccagagcggttcgaggacgctcaaggatgccatcaatgaagcgttccgggattgggtt
accaatgccgacaacaccttctactgcttcggcacggcggcggggccccatccctttccc
gccatggtgcgcgactttcagcgcatcatcggcctcgaggcgcgcgcccagatccaggcg
caggcgggccggctgcccgacgcggtgctggcctgcatcggtggcggatcgaacgccatc
ggcatcttccacccgttcatcgacgatcccggcgtgcggctgatcggcttcgaggcggcc
ggcgacggcgtcgaaaccggaaggcacgccgcgaccttcagcggcggttcccccggggcg
ttccagggatcgttctcctacctgctgcaggacgaggacgggcagaccatcgaatcccat
tccatctcagcgggtctcgattaccccggggtaggtccggaacacgcgtggctgcgcgag
agcggacgcgccgagtaccggcccatcaccgactccgaagcgatggaggcattccgcacc
ctgtgccgcaccgaggggatcatccccgccatcgaatccgcgcacgcggtggccggggcc
ctgaaggtggcccccgaattggggaaggccgcgatcatcgtggtgaacctgtccggccgt
ggggacaaggacgtcgagacggccgcgcagtggttcgggctgttgggatccagcgaccga
tga

DBGET integrated database retrieval system