KEGG   Mycobacterium intracellulare MOTT-64: OCQ_30840Help
Entry
OCQ_30840         CDS       T01755                                 

Definition
Indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mir  Mycobacterium intracellulare MOTT-64
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mir00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    OCQ_30840
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    OCQ_30840
Enzymes [BR:mir01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     OCQ_30840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3276506..3277309)
Genome map
AA seq 267 aa AA seqDB search
MLDSILEGVRADVAAREALISLSEIKAAAAAAPPPRDVMAALREPGIGVIAEVKRASPSA
GSLATIADPAKLARAYEDGGARIISVLTEERRFHGSLDDLDAVRAAVSIPILRKDFVVQP
YQIHEARAHGADMLLLIVAALEQSALVSMLDRTESLGMTALVEVHTEEEADRALKAGANV
IGVNARDLATLAVDRDCFARIAPGLPSNVIRIAESGVRGTADLLAYAGAGADAVLVGEGL
VKSGDPRAAVADLVTAGTHPSCPKPSR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtgcttgactccatcctcgagggagtccgggccgacgttgccgcgcgcgaagccctcatc
agcctgtccgagatcaaggccgccgcggcggccgcgccgccgccccgcgacgtcatggcc
gccctgcgcgagcccggaatcggcgtcatcgccgaagtcaagcgcgccagcccgtcggcg
ggttccctggcgaccattgccgatccggccaaactggccagggcgtacgaggacggcggc
gcgcgcatcatcagcgtcttgaccgaggagcgccgctttcacggttcgctcgacgatctc
gacgcggttcgggcggcggtctcgataccgattttgcgcaaagactttgtggtgcagccc
tatcagatccacgaagcgcgtgcgcacggcgccgacatgttgttgctcatcgtcgccgcg
ctggagcagtcggcgttggtgtcgatgctggaccgcaccgaatcgctgggcatgacggca
ctcgtcgaggtgcacaccgaagaggaagccgaccgcgcgctcaaggccggggccaacgta
atcggcgtcaacgcccgcgatctggccacgctggcggtggaccgggattgcttcgcgcgc
atcgctcccgggctgcccagcaacgtgatcaggatcgccgaatccggtgtgcgcggtacc
gcagacctgctggcgtacgccggtgcgggtgccgacgccgtgttggtgggcgaaggtctg
gtcaaaagtggtgacccgcgcgccgcggtcgccgatctggtcaccgcgggcacccatccg
tcctgtccgaaaccctctcgctag

DBGET integrated database retrieval system