KEGG   Mycobacterium paraintracellulare: OCQ_30960Help
Entry
OCQ_30960         CDS       T01755                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
mir  Mycobacterium paraintracellulare
Pathway
mir00340  Histidine metabolism
mir01100  Metabolic pathways
mir01110  Biosynthesis of secondary metabolites
mir01230  Biosynthesis of amino acids
Module
mir_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:mir00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    OCQ_30960
Enzymes [BR:mir01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     OCQ_30960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AFC54608
UniProt: A0A1X2L0K8
Position
complement(3286483..3287886)
Genome map
AA seq 467 aa AA seqDB search
MDTVSTIRPSPMARIDLRGAELTAARLRAALPRGGADVEAVLPKVRPIVQAVAERGAEAA
LEFGESFDGVRPPAVRVPAEALEKALAELDAAVAEALRVMIERTRAVHADQRRTDVTTTL
GPGATVTERWVPVERVGLYVPGGNAVYPSSVVMNVVPAQAAGVASLVVASPPQAQFGGLP
HPTILAAARLLGVDEVWAVGGAQAVALLAYGGTDTGAEWPGFSSDRARSASSPGADAELA
PVDMITGPGNIYVTAAKRLCRSRVGIDAEAGPTEIAILADNTADPAHVAADMISQAEHDE
MAGSVLVTPSEDLAAATDKELAAQLRTTVHRERVAAALGGRQSAIILVDDVDAGVKVVNA
YAAEHLEIQTADAASVAGRIRAAGAIFVGPYAPVSLGDYCAGSNHVLPTAGCARHSSGLS
VQTFLRGIHVVDYTEAALKDVSGHVITLAEAEDLPAHGEAVRRRFER
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggacaccgtgagcaccatccgaccgtcgccgatggcccgtatcgacctgcggggcgcg
gaattgacggctgcccgtttgcgggcggcgctgccgcgtggcggtgccgacgtggaggcg
gtgctgcccaaggtgcgcccgatcgtgcaggccgtcgcggagcgcggcgccgaggccgcc
ctcgaattcggggagtccttcgacggggtgcgacccccggccgtccgggtgcccgcggag
gcgctcgagaaagccctcgccgaactcgacgcggcggtcgccgaggccctgcgcgtgatg
atcgagcgcacccgcgcggtgcacgccgaccagcgccgcaccgacgtgacgacgacgctc
ggcccgggcgcgacggtcaccgagcggtgggtaccggtcgagcgggtgggcctctacgtg
cccggcggcaacgccgtctacccgtccagcgtcgtgatgaacgtggtgccggcgcaggcc
gccggcgtcgcctcgctggtggtggccagcccgccgcaggcccagttcggcggcctgccg
cacccgaccatcctggcagcggcccggctgctgggcgtcgacgaggtgtgggccgtcggc
ggggcgcaggccgtcgcgctgctggcctacggcggcaccgataccggggccgaatggccc
ggcttctcctcggatcgcgcacgatccgcatcgtcgccgggggcagacgccgagttggcg
cccgtcgacatgatcaccgggccgggcaacatctacgtcaccgccgccaagcggctgtgc
cgttcgcgggtcggcatcgacgccgaggccgggccgacggagatcgcgatcctggccgat
aacaccgccgaccccgcgcacgtggccgccgacatgatcagccaggccgaacacgacgaa
atggccggcagcgtgctggtgacccccagcgaagacctggccgcggccaccgacaaggaa
ctggccgcccagttgcggacgaccgtgcaccgcgagcgggtggccgccgccctgggcggg
cgccaatcggcgatcatcctcgtcgacgacgtggacgccggcgtcaaggtcgtcaacgcc
tacgctgccgaacacctggagatccagaccgccgacgcggcgagcgtggccgggcgaata
cgcgcggcgggagccatattcgtcggtccgtatgcgccggtgagcctcggggactactgc
gccggatccaatcacgtcctgccgaccgccggctgcgcgcggcattccagcggcctgtcc
gtgcagaccttcctgcgcggcatccacgtcgtcgactacaccgaggcggcgctcaaagac
gtgtccgggcacgtgatcacgctcgccgaggccgaggacctgccggcgcacggcgaggcg
gtacggcggaggttcgagcgatga

DBGET integrated database retrieval system