KEGG   Mycobacterium paraintracellulare: OCQ_33000Help
Entry
OCQ_33000         CDS       T01755                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mir  Mycobacterium paraintracellulare
Pathway
mir00010  Glycolysis / Gluconeogenesis
mir00051  Fructose and mannose metabolism
mir00562  Inositol phosphate metabolism
mir01100  Metabolic pathways
mir01110  Biosynthesis of secondary metabolites
mir01120  Microbial metabolism in diverse environments
mir01130  Biosynthesis of antibiotics
mir01200  Carbon metabolism
mir01230  Biosynthesis of amino acids
Module
mir_M00002  Glycolysis, core module involving three-carbon compounds
mir_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mir00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OCQ_33000
   00051 Fructose and mannose metabolism
    OCQ_33000
   00562 Inositol phosphate metabolism
    OCQ_33000
Enzymes [BR:mir01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     OCQ_33000
Exosome [BR:mir04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   OCQ_33000
  Exosomal proteins of bladder cancer cells
   OCQ_33000
  Exosomal proteins of melanoma cells
   OCQ_33000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFC54812
UniProt: A0A1X2KQN3
Position
complement(3555011..3555796)
Genome map
AA seq 261 aa AA seqDB search
MSRKPLIAGNWKMNLNHFEAIALVQKIAFALPDKYYDKVDVTVLPPFTDLRSVQTLVDGD
KLRLTYGGQDLSQHDAGAYTGEVSGAFLAKLGCTFVVVGHSERRTYHHEDDTVVAAKTAA
ALKHELTPIVCIGEHLEVREAGNHVIHCEEQLRGSLAGLSTEQIGKVVIAYEPVWAIGTG
RVASAADAQEVCAAIRKELASLASPQVADSVRVLYGGSVNAKNVGELVAQDDIDGGLVGG
ASLDGEQFATLAAIAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgcaagccactgatcgccggcaactggaagatgaacctcaaccacttcgaggcg
atcgcgctggtgcaaaagatcgcgttcgcgctgccggacaagtactacgacaaggtcgac
gtcacggtgctgccgccgttcaccgacctgcgcagcgtgcagaccctggtcgacggcgac
aagctgcggctgacctacggcgggcaggacctgtcccagcacgacgccggcgcctacacc
ggcgaggtcagcggcgccttcctggccaagctgggctgcacgttcgtcgtcgtcgggcac
tccgagcgcaggacgtaccaccacgaggacgacaccgtcgtcgccgccaagaccgccgcg
gcgctcaagcacgaactgaccccgatcgtctgcatcggcgagcacctcgaggtgcgcgag
gccggaaaccacgtcatccactgcgaagagcagctgcgggggtcgctggccgggctgtcc
accgaacagatcggcaaggtcgtcatcgcctacgagccggtgtgggcgatcggcaccggg
cgggtggccagcgccgccgacgcccaggaggtgtgcgcggcgatccgcaaggagttggcg
tcgctcgcctcgccccaggtcgccgactcggtgcgggtgctctacggcggctcggtcaac
gccaagaacgtcggcgagctcgtcgcccaggacgacatcgacggcggcctggtcggcggc
gcgtcgctggacggcgagcaattcgccacgctggcggccatcgccgccggtgggcctctt
ccgtga

DBGET integrated database retrieval system