KEGG   Mycobacterium paraintracellulare: OCQ_33440Help
Entry
OCQ_33440         CDS       T01755                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
mir  Mycobacterium paraintracellulare
Pathway
mir00230  Purine metabolism
mir01100  Metabolic pathways
Module
mir_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mir00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    OCQ_33440
Enzymes [BR:mir01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     OCQ_33440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_18 AAA_33 MMR_HSR1 CPT RsgA_GTPase Cytidylate_kin
Motif
Other DBs
NCBI-ProteinID: AFC54856
UniProt: A0A1X2KL89
Position
complement(3601382..3601987)
Genome map
AA seq 201 aa AA seqDB search
MVVLSGPSAVGKSTVVRCLRERVPDLHFSVSATTRAPRPGEVDGVDYHFVSPARFQQLID
EGALLEWAEIHAGLHRSGTLAEPVRDATARGFPVLIEVDLAGARAVKRAMPEALTVFLAP
PSWEDLEARLVGRGTETPEVMRRRLETARIEMAARDDFDRVVVNRRLESACAELVSLLVG
TAPDRHDPAGHTESQTTSNQD
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgtgctgtccggtccctccgcggtcggcaagtcgaccgtggtccgatgcctgcgc
gagcgggtcccggacctgcatttcagcgtctcggccaccacgcgggcgccccggcccggc
gaggtcgacggcgtcgactaccacttcgtcagccccgcccgcttccagcagctcatcgac
gagggcgccctgctggagtgggccgaaattcacgcgggcctgcaccgctcgggcaccctg
gccgagccggttcgcgacgccacggcccgcggattcccggttttgatcgaggtggacctg
gccggggccagggccgtgaagagggcgatgcccgaggccctgacggtgtttttggcgccg
cccagctgggaggacttggaggccaggctcgtcggccgcggcaccgagaccccggaggtc
atgcggcggcgcctcgagacggcccgcatcgaaatggcggcccgtgacgacttcgaccgg
gtggtcgtcaaccgtcgattggagtctgcgtgcgccgaattggtatccttgctggtggga
actgccccggaccggcacgacccggctggccacaccgaaagccagaccacatccaatcaa
gattga

DBGET integrated database retrieval system