KEGG   Mycobacterium intracellulare MOTT-64: OCQ_33520Help
Entry
OCQ_33520         CDS       T01755                                 

Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mir  Mycobacterium intracellulare MOTT-64
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mir00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    OCQ_33520
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    OCQ_33520
Enzymes [BR:mir01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     OCQ_33520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3610690..3611649)
Genome map
AA seq 319 aa AA seqDB search
MTRHLLAAGDLSLDDATAILDDADRFAQALVGREIKKLPTLRGRTIVTMFYENSTRTRVS
FEVAGKWMSADVINVSAAGSSVSKGESLRDTALTLRAAGADALIIRHPASGAAHLLAEWT
CAGGDSGPSVINAGDGTHEHPTQALLDALTIRQRLGGIEGRRVVIVGDVLHSRVARSNVM
LLHTLGAEVVLVAPPTLLPVGVDGWPVTVSNDFDAELPAADAVLMLRVQAERMNGGFFPS
VREYSSLYGLSDRRQAMLPGHAVVLHPGPMLRGMEIASSVADSSQSAVLQQVSNGVHVRM
AVLFHVLVGAESAGSEGAA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgacccgacacctgcttgccgccggggacctgagcctcgacgacgccaccgccatcctc
gacgacgccgaccgcttcgcccaggcgctggtcggccgcgagatcaagaagctgccgacg
ctgcgcggccgcaccatcgtgacgatgttctacgagaactcgacccgcacccgggtgtcc
ttcgaggtggccggcaagtggatgagcgccgacgtgatcaacgtcagcgccgccggatcg
tcggtgagcaagggcgagtcgctgcgcgacaccgcgctgacgctgcgggccgccggggcc
gatgcgctgatcatccggcacccggcgtcgggggccgcgcacctgcttgccgaatggaca
tgcgccggcggcgattccggcccctcggtgatcaacgccggcgacggcacccatgagcac
ccgacgcaggcgctgctggacgcgctcaccatccgccagcggctcggcggcatcgagggc
cggcgggtcgtgatcgtcggcgacgtcctgcacagccgggtcgcccgctccaacgtcatg
ctgctgcacaccctgggcgccgaagtggtgctggtggcaccgccgacgctgctgccggtc
ggcgtcgacggctggccggtgacggtgtcgaacgacttcgacgccgagctgcccgccgcc
gacgcggtgctgatgctgcgcgtgcaggccgagcggatgaacggcggcttcttcccgtcg
gtgcgcgaatactcgtccctgtacgggctttccgatcgccgccaggcgatgctgcccggg
cacgccgtggtgctgcaccccgggccgatgctgcgcggcatggagatcgcgtcatcggtg
gccgattcgtcgcaatcggccgtgctgcaacaggtttccaatggtgtgcacgtgcggatg
gcggtgctgttccacgtgctggtgggtgccgagtcggctggaagcgaaggggccgcatga

DBGET integrated database retrieval system