KEGG   Mycobacterium paraintracellulare: OCQ_33990Help
Entry
OCQ_33990         CDS       T01755                                 

Definition
(GenBank) class II aldolase/adducin domain protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mir  Mycobacterium paraintracellulare
Pathway
mir00051  Fructose and mannose metabolism
mir01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mir00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    OCQ_33990
Enzymes [BR:mir01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     OCQ_33990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AFC54911
UniProt: A0A1X2KGY9
Position
complement(3655561..3656358)
Genome map
AA seq 265 aa AA seqDB search
MASTFTDSKSDLMRRAAEQLTALQSKDAADAPLTTRQKLALTCRALFDAGHDSGLAGQIT
ARAERDGTYYTQRLGLGFDEITDANLLLVDEDLNVLEGDGIANPANRFHSWIYRARPDVQ
CIVHTHAFHVAALSMLEVPLIVSHMDTTPLYGDCAFLEKWPGVPVGNEEGEIISAALGDK
KAVLLAHHGHVIAGASVEEACSLGILIERAAKLQLAAMAAGTVKELPEELAREAHDWTLS
PQRSRANFAYYARRALARHPDALTS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggccagcacgttcaccgattcgaaatccgacttgatgcgccgcgcggccgagcagttg
acggcccttcaatccaaggacgccgccgatgcgccgctgaccacccgccagaagctcgcc
ctgacgtgccgcgccctgttcgacgccgggcacgattccgggttggccgggcagatcacc
gcccgcgccgagcgggacggcacctactacacccagcggctcggtctgggcttcgacgag
atcaccgacgccaacctgcttttggtcgacgaggacctcaacgtccttgagggagacgga
atcgccaaccccgccaaccgctttcacagctggatctatcgcgcccgccccgatgtgcaa
tgcatcgtgcacacgcacgcgttccacgtggccgcgctgtcgatgctggaagttccgctg
atcgtgtcccacatggacaccacgccgctctacggcgactgcgcgttcctggagaaatgg
cccggcgtgccggtcggcaacgaggagggggagatcatctccgccgcgctgggggacaag
aaggcggtcctgctggcccaccacggccacgtcatcgccggcgccagcgtcgaggaggcg
tgctcgttgggcatcctcatcgagcgcgccgcgaaactgcagctggccgcgatggccgcc
ggcaccgtcaaagagctacccgaggagctggcccgcgaggcccacgactggacactgtcg
ccgcagcgcagccgcgccaacttcgcctactacgcccgccgggccctggcccggcacccg
gacgcgctgaccagctaa

DBGET integrated database retrieval system