KEGG   Mycobacterium intracellulare MOTT-64: OCQ_34240Help
Entry
OCQ_34240         CDS       T01755                                 

Definition
holliday junction DNA helicase motor protein
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mir  Mycobacterium intracellulare MOTT-64
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mir00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    OCQ_34240
Enzymes [BR:mir01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     OCQ_34240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3682601..3683200)
Genome map
AA seq 199 aa AA seqDB search
MIAAVRGEVLEVALDHAVIEAAGVGYRVNATPSTLSTLRTGTEARLITAMIVREDSMTLY
GFTDTDTRDLFLTLLSVSGVGPRLAMATLAVHDAGALRQALHDGDVAALTRVPGIGKRSA
ERMVLELRDKVGAAGAGAAPAGAALNGHAVRGPVVEALVGLGFAVKQAEEATDKVLAAEQ
DATTSGALRAALSLLGKSR
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgcggtgcgcggcgaggtgctcgaggtggcgctcgaccatgcggtgatcgag
gccgccggcgtcggctaccgggtgaacgcgacgccgtcgacgctgtccacgctgcggacc
gggaccgaggcgcggctgatcaccgcgatgatcgtccgcgaggattcgatgacgctgtac
ggtttcaccgacaccgacacccgcgacctgtttttgaccctgctgtcggtgtcgggggtc
gggccccggctggcgatggcgaccctggccgtgcacgacgccggcgcgctgcgccaggcg
ctgcacgacggcgacgtcgccgcgctgacccgggtccccgggatcggcaaacgcagcgcc
gaacggatggttttagagctgcgggacaaggtgggcgccgccggtgcgggcgcggccccc
gcgggcgccgcgctcaacggccacgcggtccgcgggccggtggtcgaggccctggtgggc
ctcgggttcgccgtcaagcaggccgaggaagccaccgacaaggtgctggccgccgagcag
gacgcgaccacctccggtgcgctgcgcgccgccctgtcgctgctgggcaagtcccgatga

DBGET integrated database retrieval system