KEGG   Mycobacterium intracellulare MOTT-64: OCQ_37980Help
Entry
OCQ_37980         CDS       T01755                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mir  Mycobacterium intracellulare MOTT-64
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mir00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OCQ_37980
   01230 Biosynthesis of amino acids
    OCQ_37980
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OCQ_37980
   00030 Pentose phosphate pathway
    OCQ_37980
   00051 Fructose and mannose metabolism
    OCQ_37980
   00052 Galactose metabolism
    OCQ_37980
  Energy metabolism
   00680 Methane metabolism
    OCQ_37980
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    OCQ_37980
Enzymes [BR:mir01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     OCQ_37980
Protein phosphatases and associated proteins [BR:mir01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     OCQ_37980
Messenger RNA biogenesis [BR:mir03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     OCQ_37980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4032992..4034023)
Genome map
AA seq 343 aa AA seqDB search
MRIGVLTGGGDCPGLNAVIRAVVRTCDSRYGSSVVGFQDGWRGLLENRRVQLHNDDRNDR
LLAKGGTMLGTARVNPDKLRAGLNQVKQTLDDNGIDVLIPIGGEGTLTAAHWLSEENVPV
VGVPKTIDNDIDCTDVTFGHDTALTVATEAIDRLHSTAESHQRVMLVEVMGRHAGWIALN
AGLASGAHMTLIPEQPFDVEEVCRLVKRRFQRGDSHFICVVAEGAKPIPGSIALREGGID
EFGHEKFTGVAAQLGAEVEKRINKDVRVTVLGHVQRGGTPTAYDRVLATRFGVNAADAAH
AGEYGQMVSLRGQDIGRVPLADAVRQLKLVPDSRYDDAAAFFG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcggatcggagtgctcaccggaggcggcgactgccccgggctcaacgccgtcatccgg
gcggtggtgcgtacgtgcgactcccggtacggctcgtcggtggtcggatttcaggacgga
tggcgcgggttgctggagaaccggcgcgtccagctgcacaacgacgaccgcaacgaccgc
ctgctggccaagggcggaacgatgctggggaccgcgcgcgtgaatcccgacaaacttcgg
gccgggctgaaccaggtcaagcagaccctcgacgacaacgggatcgacgtcctcatcccg
atcgggggggaaggcacgctgacggccgcgcactggctctccgaggaaaacgttcccgtg
gtcggcgtgccgaagaccatcgacaacgacatcgattgcacggacgtgactttcggccac
gacaccgcgttgaccgtcgccaccgaggcgatcgaccggttgcacagcaccgccgagtcc
caccagcgcgtgatgctggtcgaggtgatgggccggcacgcgggttggattgcgctgaac
gcgggcctggcttccggcgcgcacatgacgctgatccccgagcagccattcgacgtcgaa
gaggtctgccggctcgtcaaacgtcgcttccagcgcggagattcgcacttcatctgcgtg
gtcgccgagggcgccaaacccatacccggctcgattgcgttgcgggaaggcgggattgac
gagttcggccacgagaaattcaccggtgtggccgcgcagctgggcgccgaggtggaaaag
cgcatcaacaaggacgtccgggtgaccgtcttgggtcacgtccagcgcggcggcaccccg
acggcatatgaccgggtgctggccacccggttcggcgtgaatgcggccgacgcggcgcat
gccggcgaatacggccagatggtgtcgctgcgcggccaggacatcggccgggtgccgctg
gccgatgccgtccgccagctcaagctggtgcccgacagccgctacgacgacgccgcggcc
ttcttcggctag

DBGET integrated database retrieval system