KEGG   Mycobacterium intracellulare MOTT-64: OCQ_38200Help
Entry
OCQ_38200         CDS       T01755                                 

Definition
glycosyl hydrolase family protein
Orthology
K16149  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mir  Mycobacterium intracellulare MOTT-64
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:mir00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    OCQ_38200
Enzymes [BR:mir01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     OCQ_38200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4055848..4057428
Genome map
AA seq 526 aa AA seqDB search
MNSTPDRVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWAAAYLPLMRVLNTLAGEDRQ
GLITLGVTPVVNAQLDDPYCLGGMHHWLANWRLRAAEAASVRSIPRSKSAGYQSCTPEAL
RALGIREEAEAENALEDFATLWRHGGSAPLRGLLDAGTVELLGGPLAHPFQPLLAPRLRE
FALREGLADAGQRLAHTPTGIWAPECAYAPGLEHDYAAAGVTHFMVDGPSLHGDTALGRP
VGDTDVVAFGRDLQVSYRVWSPKSGYPGHAAYRDFHTYDHLTGLKPARVTGRNVPSEGKA
PYDPERADHAVDIHVADFVETVRNRLTSESARIGRPAHVIAAFDTELFGHWWYEGPTWLE
RVLRALPEAGVRVGTLTDAIADGFVGSPVALPPSSWGSGKDWQVWAGDQVADLVQLNNEV
VDTALSTVDKALSQTATLDGPIPRDHVADQILRETLLTVSSDWPFMVSKDSAADYARYRA
HLHAHATREIAGALASGRRDTAQRLAEGWNRADGLFGALDARRLPR
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
gtgaactcgacgccagaccgggtccccggcctgttcaccctggttttgcacacccatctt
ccgtggctggcccaccacggccgctggccggtcggtgaggaatggctgtatcaatcctgg
gcggcggcctacctgccgctgatgcgcgtgctgaacacgctggccggcgaggaccgccag
ggactgatcacgctcggcgtcacgccggtggtgaacgcgcaactcgacgacccgtattgc
cttggcggcatgcatcattggctggcgaactggcggctgcgcgcagccgaggcggccagt
gtgcggtcgattccccgatcgaagtcggccggctatcagtcgtgcacgccggaggcgttg
cgcgccttggggattcgcgaggaggcggaggccgagaacgcccttgaggacttcgccacc
ctatggcggcacggcggcagcgcgccgctgcgcgggttgctcgacgccggcacggtggag
ctgctcggcgggccgctggcccacccgttccaaccgctgctcgccccccgcctgcgcgag
ttcgccctgcgcgaggggctggccgacgccgggcagcggctggcgcacacccccaccggc
atctgggcgcccgaatgcgcgtacgcgcccgggctcgaacacgactacgccgccgccggg
gtcacgcacttcatggtcgacggcccgtcactgcacggcgacactgcgctgggccggccc
gtcggcgacaccgacgtggtggcgttcgggcgcgacctgcaggtcagctaccgggtgtgg
tcgccgaagtccggctaccccgggcacgccgcctatcgcgatttccacacctatgaccac
ctcaccgggctcaagccggccagggtcaccggccgcaacgtgccctcggaaggcaaggcg
ccctacgaccccgagcgggccgaccacgccgtcgacattcacgtcgccgacttcgtcgag
acggtccgcaaccgcctgacgagcgagtccgcgcgcatcgggcggcccgcgcatgtgatc
gccgccttcgacaccgagctgttcggccactggtggtacgagggcccgacctggttggag
cgggtgctgcgcgccctgcccgaggccggcgtgcgggtgggcaccctgaccgacgcgatc
gccgacggcttcgtcggtagcccggtggccctgccgcccagctcgtggggttcgggcaag
gactggcaggtgtgggccggcgaccaggtcgccgacctggtgcagctcaacaacgaagtg
gtcgacaccgcgctgagcaccgtcgacaaggcgctgtcccaaaccgcgacgctggacggg
cccatcccccgcgaccacgtcgccgaccagatcctgcgcgaaaccttgctgacggtctcc
agcgactggccgttcatggtgagcaaggattcggccgccgactacgcccgctaccgcgcc
cacctgcacgcgcacgccacccgtgagatcgcgggggcgctggcgtccgggcggcgcgac
accgcgcagcgcctggcggaggggtggaaccgcgcggacggactcttcggcgccctcgac
gcccgcaggttgccccgatga

DBGET integrated database retrieval system