KEGG   Mycobacterium intracellulare MOTT-64: OCQ_38210Help
Entry
OCQ_38210         CDS       T01755                                 

Definition
glycoside hydrolase family protein
Orthology
K16150  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
mir  Mycobacterium intracellulare MOTT-64
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:mir00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    OCQ_38210
Enzymes [BR:mir01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     OCQ_38210
Glycosyltransferases [BR:mir01003]
 Polysaccharide
  Storage polysaccharide
   OCQ_38210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4057430..4058686
Genome map
AA seq 418 aa AA seqDB search
MDHEVKILMVSWEYPPVVVGGLGRHVHHLSTALAAAGHDVVVLSRRPTGTDPRSHPSSDQ
ISEGVRVIAAAQDPHEFTFGTDMMAWTLAMGHSMVRAGLSLKKPGSSHAWRPDVVHAHDW
LVAHPAIALAQFYDVPMVSTIHATEAGRHSGWVSGGLSRQVHAVESWLVRESDSLITCSG
SMADEITELFGPGLAEITVICNGIETARWPFAARRPRTGPAELLYLGRLEYEKGVHDVIA
ALPRVRRTHPGTTLTIAGEGTQQGWLIEQARKHRVLKAIRFVGHLEHAELLAVLHRADAA
VLPSHYEPFGIVALEAAAAGTPLVTSNIGGLGEAVIDGRTGVSCPPRDVTRLAAAIRTVL
DDPRAAQQRARAARERLTSDFDWHTVADKTAQVYLSAKRGERQPQARLPIVEHALPDR
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
gtggaccacgaagtgaagatcctgatggtgtcgtgggagtacccgccggtggtcgtcggc
gggctcggccggcacgtccaccacctgtccaccgcgctggcggccgcaggtcacgacgtc
gtggtgctgtcacgccgacccaccgggaccgatccccgcagccatccgtcgtccgaccag
atcagcgagggtgttcgggtgatcgcggccgcgcaggatccgcacgagttcaccttcggc
accgacatgatggcctggacgctcgcgatggggcattccatggtccgcgccgggctgagc
ctgaagaaacccggcagcagccacgcgtggcggcccgacgtcgtgcacgcccacgactgg
ctggtggcccatccggcgatcgcgctggcccaattctatgacgtgccaatggtttccacg
atccacgcgaccgaggccggtcggcattccggctgggtcagcggcgggctcagccgtcag
gtgcacgcggtcgagtcctggctggtgcgcgaatccgattcgctgatcacctgttcgggg
tcgatggccgacgagatcaccgaactgttcggtccggggctggccgagatcaccgtgatc
tgcaacggcatcgagacggcgcggtggccgttcgcggcgcggcggccgcgcacggggccg
gccgaactgctttacctggggcggctggagtacgaaaagggggtgcacgacgtcatcgcc
gcgctcccgcgggtcaggcgcacccacccgggcaccacgctgaccatcgccggcgagggc
acccagcagggctggctcatcgagcaagcccgtaaacaccgggtgctcaaggcgattcgg
ttcgtcgggcacctcgagcacgcggagctgttggccgtactgcatcgcgccgacgccgcg
gtgttgcccagccactacgagccgttcggcatcgtggcgctcgaggcggccgcggccggc
actcccctggtgacgtcgaacatcggcgggctgggcgaggcggtgatcgacggtcggacc
ggcgtatcgtgcccgccccgcgacgtgacccggctggccgcggcgattcgcaccgtcctc
gacgatccgcgcgccgcgcaacaacgcgcccgggccgcccgcgaacgcctcacgtccgac
ttcgattggcatacggtggccgacaagaccgcgcaggtctatctgtcggccaagcgcggc
gagcggcagccgcaggcgcggctccccatcgtcgaacacgccttgccggaccggtag

DBGET integrated database retrieval system