KEGG   Mycobacterium intracellulare MOTT-64: OCQ_40300Help
Entry
OCQ_40300         CDS       T01755                                 

Definition
hypothetical protein
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
mir  Mycobacterium intracellulare MOTT-64
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:mir00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    OCQ_40300
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    OCQ_40300
Enzymes [BR:mir01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     OCQ_40300
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     OCQ_40300
Two-component system [BR:mir02022]
 CheA family
  CheA-CheYBV
   OCQ_40300
Bacterial motility proteins [BR:mir02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    OCQ_40300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4256338..4257114)
Genome map
AA seq 258 aa AA seqDB search
MESATDEAFEALLRYMRDSRGFDFTGYKRTSLMRRVRRRMDQAGYTSFEEYLDFLQASSD
EFTALFNTILINVTSFFRDAEAWDYVGAEVIPRLLAERGPDDPIRVWSAGCASGQEAYTL
AMMLAEALGAEEFRQRVKIYATDVDEDALGEERGASYDAKAVESVPPEMLGRYFEQVNGR
YVFRKDLRRAVIFGRNDLVTDAPISRVDPLVCRNALMYLNAETQRMCWGVYTLRSCPRAR
CFSGTPRCSSVMVTDSRR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
ttggaatccgccactgacgaggctttcgaggccctgttgcgctatatgcgcgattcgcgg
ggcttcgacttcacgggctacaagcgcacctcactgatgcgccgcgtccgtcgccggatg
gaccaggcgggttacacctcgttcgaggaataccttgactttctgcaggccagctcggac
gaattcaccgcgctcttcaacaccatcctgatcaacgtcacgtcgttcttccgcgacgcg
gaggcctgggactacgtgggcgccgaggtcatcccgcggctgctggccgagcggggaccc
gacgacccgatccgggtgtggagcgccggatgcgcgtcgggccaggaggcctacacgctg
gccatgatgctggccgaggcgctgggagccgaggagtttcgccagcgggtcaaaatctat
gccacggatgtcgacgaagatgcactcggcgaggagcgcggggcgtcctacgacgccaag
gcggtcgagtccgtgccgccggaaatgctcgggcgctacttcgagcaggtcaacggccgc
tacgtctttcgcaaagacctgcgccgggcggtgatcttcggccgcaatgacctggtcacg
gatgcgccgatatcacgggtcgaccctctggtgtgccgcaacgcgttgatgtatctcaac
gcggagacgcagcgaatgtgttggggcgtctacactttgcgctcatgccccagggcacgc
tgtttctcgggcacgccgagatgctcctcagtcatggtgaccgattcacgccggtga

DBGET integrated database retrieval system