KEGG   Mycobacterium intracellulare MOTT-64: OCQ_40320Help
Entry
OCQ_40320         CDS       T01755                                 

Definition
hypothetical protein
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
mir  Mycobacterium intracellulare MOTT-64
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:mir02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:mir02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4257924..4258709)
Genome map
AA seq 261 aa AA seqDB search
MATSRATSRASDRHLLVSDHHVLLSQGPTENGHRPAINALFRSVAVAFGPRAIGVLLSGV
LDDSVLGMGAIRARGGTAIGQSPEDALFPAMPVNAAEAGVVDRQADAADIGAVLKELSHR
EIEGFAMECDAAMELENRIAMRSRFATDFDTEKLGSPSGYTCPDCNGSLVSISEGNFRCQ
VGHAWTAEALLGARDNELEGALWIAVRSLREKARLARDMADRAGPGLLVRRYAAIAEETE
RALHVLSDRLSGAARQPGDAG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtggcgacctcgagggcgacctccagggcctccgatcgccacctgctcgtctccgaccat
cacgtcctgctgtcccaggggcccaccgagaacgggcatcggccggctatcaatgcgttg
ttccgatcggtcgccgtagcattcgggccccgcgcgatcggcgtgctgctgtccggcgtg
ctcgacgactccgtgctgggaatgggagccatccgtgcccgaggcggcaccgccatcggc
cagtcacccgaggacgcattgttccccgcgatgcccgtcaacgccgccgaggccggcgtg
gtggatcggcaggccgacgcggccgacatcggagccgtcctcaaagagctgtcgcaccga
gagatagagggttttgccatggagtgcgacgccgcgatggagctcgagaaccgcatcgcc
atgaggtcgcggttcgcgaccgacttcgacacggaaaaactggggtcgccgtccggctac
acctgccccgattgcaacggttcgctggtttccatcagtgagggcaacttccgctgccag
gtcggccacgcctggacggccgaagccttgctcggcgcgcgggacaacgagctcgagggg
gcgctgtggatcgcggtgcgcagcctgcgggaaaaggcccggctcgcaagggacatggcc
gacagggccgggccgggactgctcgtccgccgctacgcggcgatcgccgaggaaaccgaa
cgcgcgctgcacgtgctcagcgaccggctgtccggcgccgcccgacagccgggtgacgcc
ggatga

DBGET integrated database retrieval system