KEGG   Mycobacterium intracellulare MOTT-64: OCQ_40850Help
Entry
OCQ_40850         CDS       T01755                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
mir  Mycobacterium intracellulare MOTT-64
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:mir00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:mir00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4308610..4309098
Genome map
AA seq 162 aa AA seqDB search
MTLKDIALNTLDGRPTTLAELSDGATLVVNVASKCGLTPQYTALEKLAKDYRDRGLTVVG
VPCNQFMGQEPGTADEIQEFCSTTYGVTFPLLAKTDVNGDGRHPLYAELTKAADADGQAG
DIQWNFEKFLLAPDGAVVQRFRPRTEPDAPEVISAIEAVLPR
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
gtgaccctcaaagacatcgccctgaacaccctcgacggccggcccaccacgctggccgaa
ttgtccgacggcgcaacgctcgtcgtcaacgtggcctccaaatgcgggctcactccgcag
tacacggccctggagaagctggccaaggactaccgcgaccgcggcctgaccgtcgtcggc
gtcccctgtaaccagttcatgggacaggaacccggcacggccgacgagatccaggagttc
tgctcgacgacctacggggtgacgttcccgttgttggcgaagaccgacgtcaacggcgac
ggccgccacccgctgtacgccgagttgacgaaagccgccgacgccgatggccaggcggga
gacatccagtggaacttcgagaagttcctcctcgcacccgacggtgcggtggtgcagcgc
ttccggccccgcaccgagcccgacgcccccgaggtcatcagcgccatcgaggccgtgctg
ccgcggtag

DBGET integrated database retrieval system