KEGG   Mycobacterium intracellulare MOTT-64: OCQ_42910Help
Entry
OCQ_42910         CDS       T01755                                 

Definition
succinate dehydrogenase hydrophobic membrane anchor protein SdhD
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
mir  Mycobacterium intracellulare MOTT-64
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:mir01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mir00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mir00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:mir00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4518343..4518813
Genome map
AA seq 156 aa AA seqDB search
MSSPDLQLTRGQTAPVKQRSYDRPASLDNPRSPRRRAGIPNFEKFAWLFMRFSGIALFVL
AIGHLFIMLMWDNGVYRIDFNYVAQRWASPFWQFWDLALLWLAQLHGGNGLRTIIDDYSR
KDSTRFWLNSLLLLSMGFTLVLGTYVLLTFDPNIHA
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgagcagccccgaccttcagctgacccgcggccagacggcgccggtcaaacaacgcagc
tacgaccggcccgccagcctggacaatccccgctcgccgcggcgccgggccggcatcccc
aacttcgagaagttcgcctggctgttcatgcggttctcgggcatcgcgctgttcgtgctg
gcgatcggccacctgttcatcatgctgatgtgggacaacggcgtgtaccgcatcgacttc
aactatgtggcgcagcgctgggcgtcgccgttctggcaattctgggacctcgcgctgctg
tggctggcgcagctgcacggcggcaacggcctgcgcacgatcatcgacgactacagccgc
aaggacagcacccggttctggctcaacagcctgctgttgctgtcgatggggttcacgttg
gtgctgggcacctacgtgctgctgacgttcgaccccaacattcacgcctga

DBGET integrated database retrieval system