KEGG   Mycobacterium intracellulare MOTT-64: OCQ_43770Help
Entry
OCQ_43770         CDS       T01755                                 

Definition
glucosamine--fructose-6-phosphate aminotransferase (EC:2.6.1.16)
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
mir  Mycobacterium intracellulare MOTT-64
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mir00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    OCQ_43770
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    OCQ_43770
Enzymes [BR:mir01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     OCQ_43770
Peptidases [BR:mir01002]
 Cysteine Peptidases
  Family C44
   OCQ_43770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4608826..4610691)
Genome map
AA seq 621 aa AA seqDB search
MCGIVGYVGQQPACDVVMAALRRMEYRGYDSSGIALANGDGTLTVSRRAGRLANLEEAVA
QMPRHSLTGTTGLGHTRWATHGRPTDRNAHPHRDAAGKIAVVHNGIIENYANLRHELEAQ
GVEFASDTDTEVAVHLVAQAYRHGETAGDFPASVLAVLRRLDGHFTLVFANADDPGTIVA
ARRSTPLVLGIGDGEMFVGSDVAAFIPHTRNAVELGQDQAVVITADGYRITDFDGNDDVE
YREFHIDWDLAAAEKGGYEYFMLKEIAEQPAAVADTLLGHFVDGRIVLDEQRLSDQELRE
IDKVFVVACGTAYHSGLLAKYAIEHWTRLPVEVELSSEFRYRDPVLDRSTLVVAISQSGE
TADTLEAVRHAKEQKAKVLAICNTNGSQIPRECDAVLYTRAGPEIGVASTKTFLAQITAN
YLVGLALAQARGTKYPDEVAREYHELEAMPDVVARVLATIKPVAALAYQFAQSPTVLFLG
RHVGYPVALEGALKLKELAYMHAEGFAAGELKHGPIALIEDDLPVIVVMPSPKGSAVLHA
KLLSNIREIQARGAITIVIAEEGDDTVRPYADHLIEIPSVSTLLQPLLSTIPLQVFAASV
AQARGYDVDKPRNLAKSVTVE
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaattgtcggctatgtcgggcagcagcccgcctgtgacgtcgtcatggccgcg
ctgcggcggatggagtaccgcgggtacgactcgtcgggcatcgcgctggcgaacggcgac
ggcaccctgacggtgagccgccgcgccggccggctggccaacctggaagaggcggtcgcc
cagatgccgcggcactcgctgaccggcaccaccggcctgggccacacccggtgggccacc
cacgggcgccccaccgaccgcaacgcccacccgcaccgcgacgccgccggcaagatcgcg
gtggtccacaacggcatcatcgagaactacgcgaacctgcgccacgagctcgaggcccag
ggcgtggagttcgccagcgacaccgacaccgaggtcgcggtgcacctggtggcgcaggcc
taccgccacggcgagaccgccggcgatttccccgcgtcggtcctcgcggtgctgcgccgc
ctcgacggccacttcacgctggtgttcgccaacgccgacgaccccggcaccatcgtcgcc
gcccgccgctccaccccgctggtgctcggcatcggcgacggcgagatgttcgtcggctcc
gacgtcgcggccttcatcccgcacacccgcaacgccgtcgaactcggccaggaccaggcc
gtggtgatcaccgcggacggctaccggatcaccgacttcgacggcaacgacgatgtcgaa
taccgcgagttccatatcgattgggatctggccgccgccgaaaaaggtggctacgagtac
ttcatgctcaaggagatcgccgagcaacccgccgccgtcgccgacaccctgctgggccat
ttcgtcgacggccggatcgtgctcgacgagcagcggctctccgatcaggaactgcgcgag
atcgacaaggtgttcgtagtggcctgcggcaccgcgtaccactccgggctgctggcgaag
tacgcgatcgagcactggacgcggctgccggtcgaggtggagctgtccagcgaattccgt
taccgggacccggttttggaccgcagcaccctggtggtcgccatctcgcagtccggcgag
accgccgacacgctcgaggccgtccggcacgccaaggagcagaaggccaaggtgctggcg
atctgcaacaccaacggctcgcagatcccgcgcgagtgcgacgcggtgctctacacccgc
gccggcccggagatcggggtggcgtcgacgaagacgttcctggcgcagatcaccgccaac
tatctggtcggcctggcgctggcgcaggcccggggcaccaagtaccccgacgaggtcgcg
cgcgagtaccacgagctggaagccatgccggacgtcgtcgcgcgggtcctcgcgacgatc
aagccggtggccgcgctggcctaccaattcgcccagtcgccgacggtgctgttcctgggc
cgccacgtcggctacccggtggcgctggaaggtgcgctcaaactcaaggaactggcctac
atgcacgccgaggggttcgccgccggcgagctcaagcacggccccatcgcgctgatcgag
gacgatctgcccgtcatcgtcgtcatgccgtcccccaaggggtccgcggtgctgcacgcc
aagctgctgtccaacatccgcgaaatccaggcccgcggggcgatcaccatcgtgatcgcc
gaggaaggcgacgacaccgtgcgcccctacgccgaccacttgatcgaaatcccttccgtg
tcaacgcttttgcagcccctgctgtcgacgatcccgcttcaggtgttcgccgcgtccgtg
gcccaggcgcgcggctacgacgtggacaagccgcgcaacctggccaagtccgtcaccgtc
gagtag

DBGET integrated database retrieval system