KEGG   Mycobacterium intracellulare MOTT-64: OCQ_44100Help
Entry
OCQ_44100         CDS       T01755                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
mir  Mycobacterium intracellulare MOTT-64
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mir00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    OCQ_44100
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    OCQ_44100
Enzymes [BR:mir01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     OCQ_44100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4640418..4641047
Genome map
AA seq 209 aa AA seqDB search
MGSDVEVRELKVPGAWEITPAVHGDSRGHFFEWLTDKGFRSFAGHRLDVRQANCSVSSAG
VLRGLHFAQVPPSQAKYVTCVRGAVFDVVVDIRVGSPTFGQWDSVLLDDTEHRTIYLSEG
LGHGFLALQDNSTVMYLCSAEYNPQREHTICATDPALGIDWPLVDGAPPTLSDRDAAAPS
LDDVRASGLLPTWEETNAFVEGLRAKPTN
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
gtgggcagtgacgtggaagttcgcgagctgaaagttcccggcgcctgggagatcaccccc
gccgttcatggcgattcgcggggtcatttcttcgaatggctgaccgacaagggattcagg
tccttcgccggtcaccggttggatgttcggcaggccaattgctcggtgtcatcggccggc
gtgctgcgcggcctgcacttcgcccaggtaccgccgagccaggccaagtacgtgacctgc
gtgcgcggggcggtattcgacgtcgtcgtcgacatccgggtgggctcaccgacattcggt
cagtgggactcggtgctgctcgacgacaccgagcacaggacgatctacctctccgagggc
ctcggacacggtttcctggcgctgcaagacaattcgacggtgatgtacttgtgctcggcg
gaatacaacccgcaacgcgaacacaccatttgcgcaaccgatccggcgctggggatcgat
tggccgctggtggacggcgcgccgcccaccctgtccgaccgcgacgcggcggcccccagc
ctcgacgacgtacgcgcctccggcctactccccacgtgggaggagacgaacgcgttcgtc
gagggtttgcgggcaaagcccacgaattga

DBGET integrated database retrieval system