KEGG   Mycobacterium intracellulare MOTT-64: OCQ_44410Help
Entry
OCQ_44410         CDS       T01755                                 

Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mir  Mycobacterium intracellulare MOTT-64
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mir00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    OCQ_44410
Enzymes [BR:mir01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     OCQ_44410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4672006..4672659
Genome map
AA seq 217 aa AA seqDB search
MKFVENAETAVLDAAKDMLRRGLVEGTAGNISARRADGNIVITPSSVDYRDMQLDDLVLV
DPGGSVLQAADGRSPSSEMQLHLACFAAFDDIGSVIHSHPVWATMFAIAHQPIPACIDEF
AVYCGGDVRCTDYAASGTADVGTNAVAALEGRAAALIANHGLVAAGPRPDKVLHVTALVE
RTAQIVWGARALGGPVPIPEDVNNNFAAVYGYLRANA
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcgtcgagaacgcggagaccgcggtgctggacgcggccaaggacatgctgcgc
cggggccttgtggagggcaccgccggcaacatctcggcgcgccgcgccgacggcaacatc
gtcatcaccccgtcttccgtcgactaccgcgacatgcagctcgacgacctcgtgctggtc
gatccgggcggctcggtgctgcaggcggccgatggccggtcgccgtcctcggagatgcag
ttgcacttggcctgctttgccgcgttcgacgacatcggcagcgtcattcacagtcatccg
gtgtgggcgaccatgttcgccatcgcccaccaaccgatcccggcgtgcatcgacgagttc
gcggtgtattgcggcggcgacgtccggtgcaccgattacgccgcgtccgggaccgccgac
gtgggtaccaacgcggtcgccgcgctcgagggccgcgccgccgccctgatcgccaaccac
ggcctggtggcggcgggaccgcggcccgacaaggttttgcatgtcaccgcgctggtggag
cgcaccgcccaaatcgtttggggcgcacgcgctctcggggggccggtgccgatccccgag
gacgtcaacaacaacttcgccgcggtctacggttatctgcgggccaacgcctga

DBGET integrated database retrieval system