KEGG   Mycobacterium intracellulare MOTT-64: OCQ_45190Help
Entry
OCQ_45190         CDS       T01755                                 

Definition
sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mir  Mycobacterium intracellulare MOTT-64
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mir00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OCQ_45190
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OCQ_45190
   00052 Galactose metabolism
    OCQ_45190
   00500 Starch and sucrose metabolism
    OCQ_45190
   00520 Amino sugar and nucleotide sugar metabolism
    OCQ_45190
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    OCQ_45190
   00524 Butirosin and neomycin biosynthesis
    OCQ_45190
Enzymes [BR:mir01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     OCQ_45190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4738795..4739715)
Genome map
AA seq 306 aa AA seqDB search
MPTLCLDIGGTKIAAALVDSAGALVHSAIRPTPVTTAAGDVWAVVEAMIADAVRAADAPI
TAVGIASAGPIDLHTGSVSPINIAGWDRFPLRDRVAAAVPGVPVVLGGDGLCMALGEHWI
GAGRSAGPDARFLLGMVVSTGVGGGLVLDGVPYAGRTGNAGHVGHIVVELDGPPCTCGGR
GCVETVASGPWMVRWARDNGWAAPPGAGARDLAVAAAAGDPVARRAFHRSANALAAMIAS
VGAVCDLDLVVIGGGVSKSGPLLFDPLRAKLADYAGLDFLSGLRVVPGELGGAAGLIGAA
RLAALG
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgccaaccctctgcctggacatcggcggcaccaaaatcgccgccgctctggtcgattcg
gccggcgcgctggtgcacagcgcgatccgccccaccccggtcacgaccgccgccggcgac
gtgtgggccgtcgtcgaggcgatgatcgccgacgcggtgcgcgcggccgacgccccgatc
accgccgtcggcatcgcctcggccgggccgatcgacctgcacaccggatcggtcagcccg
atcaacatcgcgggctgggaccgattcccgctgcgcgacagggtcgccgccgcggtgccc
ggggtgccggtggtgctgggcggcgacggcctgtgtatggcgttgggcgagcactggatc
ggggcgggccgcagcgcggggccggacgcccggttcctgctgggcatggtggtctccacc
ggggtgggcggcggtctggtgctcgacggcgtcccctacgccgggcgcaccggcaacgcc
ggccacgtcgggcacatcgtcgtcgaactggacgggccgccgtgcacgtgcggcggccgc
ggctgcgtggagacggtggcgtccgggccgtggatggtgcgctgggcgcgcgataacggg
tgggcggcgccgcccggcgcgggcgccagggacctggccgtcgcggcggcggccggagac
ccggtggcccggcgggcctttcaccgatcggccaacgcgctcgccgcgatgatcgcctcg
gtcggcgcggtctgcgatctggacctcgtcgtgatcgggggaggggtgtccaaatccggg
ccgctgctcttcgaccccctgcgggcgaagctggccgactacgcggggctggacttcctg
tccgggctgcgggtggtgcccggcgagctcggcggtgcggccggcctgatcggcgcggcc
cgcctcgctgccctgggctga

DBGET integrated database retrieval system