KEGG   Mycobacterium intracellulare MOTT-64: OCQ_45510Help
Entry
OCQ_45510         CDS       T01755                                 

Definition
hypothetical protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mir  Mycobacterium intracellulare MOTT-64
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mir00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    OCQ_45510
Enzymes [BR:mir01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     OCQ_45510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4773249..4774970
Genome map
AA seq 573 aa AA seqDB search
MTADVMFATGLLRTFSDAGVFEAADVHVAQRLTALTGESDERVALAVALVVRALRGGSVC
VDLRAASGLLGDADLPWPGADDWLAVVRASALLGPPPVLRFFGDLLYFDRYWLEEEQVCT
DLLALSASPVGIESSSYERLFEPGYEEQRAAAEIAVSQAVTVLTGGPGTGKTTTIARLLA
LLLEHAERAGMPPPRIALAAPTGKAAARLAEAVAAGAQRLGAADRARLAGLSGTTLHRLL
GPRPDTSVRFKHNRANRLPHDVIVVDETSMVSLTMMARLAEAVRPDSRLILVGDPDQLAS
VEAGAVLADLVDGLSARGDVRVAALRTPHRYGTSIGALAEAIRVGDADRVVELLAAGGEH
VEWVDAQRPADRLREVLVAHALRLRSAALLGAADEALATLDEHRLLCAHREGPYGATHWN
TLVQKWIAEATGQPAWSQWYAGRPLLVTANDYGLRLYNGDTGVAVTGAEGLRAVIAGASG
PLDFATSRLGEVETMHAMTIHKSQGSQADEVTVLIPPEDSRLLTRELFYTAVTRAQTRVR
VVGPEASVRAAIERRAMRATGLRQRLRADAAAT
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgacggcagacgtgatgttcgcgaccggattgctgcgcacgttcagcgatgccggcgtc
ttcgaggcggcggacgtgcatgtggcgcaacggcttaccgcgctcaccggcgagtccgac
gaacgggtggccctggcggtcgcgctggtggtgcgcgcgctgcggggcggttcggtctgc
gtcgatctccgcgcggcgtccgggctgctcggcgacgccgacctgccgtggcccggcgcc
gacgactggctggcggtggtgcgggccagcgcgttgctcgggccgccgccggtgctgcgg
tttttcggcgatctgctgtacttcgaccggtactggctcgaggaggagcaggtgtgcacc
gacctgctggccttgtcggcgtcgccggtcggcatcgaatcgtccagttacgaacggctt
ttcgagcccgggtacgaggagcagcgggccgccgccgaaatcgcggtgtcgcaggcggtg
accgtgctgaccggtggccccggcaccggcaagaccaccacgatcgcgcggctgctcgcc
ctgctcctcgagcatgccgagcgggccgggatgccgccgccgcggatcgcgctggccgca
ccgaccggcaaggcggcggcgcggctggccgaggcggtggccgcgggggcccaacggctc
ggcgcggccgaccgggcgcggctggccggcctgtccgggaccacgctgcaccggctgctc
ggtccccggccggatacgtcggtgcggttcaagcacaatcgcgccaaccggctgccgcac
gacgtcatcgtggtggacgagacgtcgatggtgtcgttgacgatgatggcccggctggcc
gaagcggtccgcccggactcccggttgattctggtcggcgacccggaccagctggcctcg
gtggaggcgggcgccgtgctggccgacctggtggacgggctgtccgcccgcggcgacgtg
cgggtggccgccctgcgcacgccgcaccgatacggcacgtcgatcggcgcgctggccgag
gcgattcgggtcggcgacgcggaccgggtggtggagctgctggcggccgggggcgagcac
gtcgagtgggtggatgcgcagcgcccggccgatcggctgcgcgaggtgctcgtcgcgcac
gcgctgcggctgcggtcggccgcgctgctgggcgcggccgacgaggcgctggccacgctg
gacgaacaccggctgctgtgcgcgcaccgcgagggcccgtatggggcgacacactggaac
acgttggtgcagaagtggattgccgaggcgacggggcagccggcatggtcgcagtggtac
gccgggcgcccgctgctggtgaccgccaacgactacggcctgcggctctacaacggcgac
accggtgtggcggtgaccggcgcggagggcctgcgggcggtcatcgccggtgccagcggg
ccgctagacttcgcgaccagccgtctcggcgaggtggagacgatgcacgccatgaccatc
cacaagagtcagggcagccaggccgacgaggtgaccgtgctgataccgccggaggattcg
cgactgctgacgcgggaactgttctacacggccgtgacccgggcgcagaccagggtgcgg
gtggtggggcccgaggcctcggtgcgcgcggcgatcgagcgccgggcgatgcgggccacc
ggattgcggcaacggctgcgggccgacgccgccgcaacgtga

DBGET integrated database retrieval system