KEGG   Mycobacterium paraintracellulare: OCQ_46370Help
Entry
OCQ_46370         CDS       T01755                                 

Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
mir  Mycobacterium paraintracellulare
Pathway
mir00860  Porphyrin and chlorophyll metabolism
mir01100  Metabolic pathways
mir01110  Biosynthesis of secondary metabolites
mir01120  Microbial metabolism in diverse environments
Module
mir_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mir00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    OCQ_46370
Enzymes [BR:mir01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     OCQ_46370
Exosome [BR:mir04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OCQ_46370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD OMPdecase
Motif
Other DBs
NCBI-ProteinID: AFC56149
Position
complement(4866013..4866936)
Genome map
AA seq 307 aa AA seqDB search
MVAQTSLEPRHLVLPMFVADGIDEPRPIASMPGVVQHTRDSLRAAAASAVAAGVGGLMLF
GVPRDEDKDAVGSAGTDPDGILNVALRDLAKDLGEATVLMADTCLDEFTDHGHCGVLDDR
GRVDNDATVARYVKLAVAQAESGAHVVGPSGMMDGQVGAIRDGLDTAGHTDVAILAYAAK
FASAFYGPFREAVSSSLSGDRRTYQQEAGNSREALREIQLDLDEGADIVMVKPAMGYLDV
VSAAASISPVPVAAYQVSGEYAMICAAAANNWIDKRAAALESLTSIRRAGADIVLTYWAA
DAAGWLS
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
ttggtcgcgcaaacgtcgctggagccaaggcatttggtgctgccgatgttcgtcgccgac
ggcatcgacgagccccggccgatcgcctcgatgccgggggtggtccaacacacccgcgat
tcgttgcgcgccgccgccgccagcgccgtcgccgccggggtgggcgggctaatgctgttc
ggtgtgccgcgtgatgaggacaaggacgcggtggggtcggccggcaccgatcccgacggc
atcctcaacgtcgccctgcgcgacctggccaaggacctcggcgaggccaccgtgctgatg
gccgacacctgcctggacgagttcaccgaccacggccactgcggcgtcctcgacgaccgc
ggtcgggtcgacaacgacgcgaccgtagcccgatatgtgaaactcgctgtggcgcaagcg
gaatcgggcgcgcacgtggtaggtccgagtgggatgatggacggtcaggtgggcgcgatt
cgcgacgggctggacacggccggccataccgacgtggcgatcctcgcctacgccgccaag
ttcgcatcggcgttctacggtccgttccgcgaagcggtcagttccagcctctccggcgac
cggcgcacctatcagcaggaggcgggcaattcccgcgaggcgctccgcgagatccagctc
gatctggacgagggcgccgacattgtgatggtgaagccggcgatgggttatctggacgtg
gtgtcggcggcggcctcgatttcgccggtgccggtggccgcctatcaggtgtcgggggag
tacgcgatgatttgcgctgcggccgcgaacaattggatcgacaagcgcgcggcggccctg
gaatcattgacgagcatccggcgggccggagccgatatcgttctcacctattgggccgcg
gacgcggcagggtggctttcgtga

DBGET integrated database retrieval system