KEGG   Mycobacterium intracellulare MOTT-64: OCQ_49110Help
Entry
OCQ_49110         CDS       T01755                                 

Definition
uroporphyrinogen-III synthetase/response regulator domain protein (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mir  Mycobacterium intracellulare MOTT-64
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:mir00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    OCQ_49110
Enzymes [BR:mir01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     OCQ_49110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5138004..5139167
Genome map
AA seq 387 aa AA seqDB search
MAPQLAPPDSAPLTGYRIAVTSANRAEELCALLRRNGAEVSSAAAIDLIALPEDEELQRH
TEAVIAEPPDILVAHTGIGFRGWVAAADGWGLATQLLASLSRARIVARGPKATGALRAAG
LHEEWSPRSESSSEVLRYLLESDVAGKRVAVQLHGAADTWDPFPEFLNGLRSAGAQVVPI
HVYRWKPTPAGGEFDQLVTSVARRQFDAVTFTSAPAGAALLERSRELGVEEQLLQALRSD
VHAMCVGPVTAQPLLRAGVPTSSPERMRLGALARHIAQELPTLRSTTIRAAGHEMEIRGT
CVLVDGSPRSLSGSGMATLRALAERPGDVVARNDLLRVLPGNSNDPHAVDTAVLRLRTAL
GDKNIIATVVKRGYRLAIDHPDESPWH
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggccccccaactggccccaccagactccgcgccgctgaccggctaccggatcgccgtg
acgtcggcgaaccgggccgaagagctgtgcgcgttgctgcgccgcaacggcgcggaggtg
tccagcgccgcggccatcgacctcatcgcgctgcccgaagacgaagaactgcagcgccac
accgaagcggtcatcgccgagcctcccgatatcttggtggcgcacaccggcatcggcttc
cgcggctgggtcgccgcggccgacggctggggactggccacccagctgctggcgtccctg
tcccgggcgcggatcgtggcccgcgggccgaaggcgaccggcgccttgcgcgccgccgga
ctgcacgaggagtggtcgcccaggtccgaatcgtcgagcgaggtcctgcgctacctgctc
gaatcggatgtcgccggtaagcgggtcgcggtccagctgcacggcgcggccgacacctgg
gatccgttcccggaattcctcaacgggttgcggtccgcgggcgcccaggtggtccccatc
cacgtatatcgctggaaaccaacgccggccggcggcgagttcgaccaactcgtcacctcg
gtcgcccggcggcagttcgacgcggtgaccttcacctcggcgcccgcgggcgcggcgctg
ctggagcgcagccgcgagttgggcgtcgaagagcaactgctgcaagcgcttcgcagcgac
gtgcacgcgatgtgcgtgggcccggtcaccgcgcagcccctgctccgcgccggggtcccc
acgtcgtcgcccgagcgaatgcggttgggggcgttggcccgtcacatcgcccaggagctc
ccgacccttcgctcgaccaccatccgggccgccggccacgagatggagatccgcgggacc
tgcgtgctggtcgacggttcgccgcggtccctgtcgggatcgggaatggcgacgctgcgc
gcgctggcggagcgccccggcgacgtcgtcgcgcgcaacgacctgttgcgggtgcttccc
ggcaacagcaacgatccccacgccgtcgacacggccgtgctgcggctgcgaacggcgctg
ggcgacaagaacatcatcgcgacggtggtcaagcgtggctaccggctcgcgatcgaccat
ccggacgaatccccatggcactga

DBGET integrated database retrieval system