KEGG   Mycobacterium intracellulare MOTT-64: OCQ_50840Help
Entry
OCQ_50840         CDS       T01755                                 

Definition
3-beta hydroxysteroid dehydrogenase/isomerase family protein
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
mir  Mycobacterium intracellulare MOTT-64
Brite
Enzymes [BR:mir01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     OCQ_50840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5318671..5319690)
Genome map
AA seq 339 aa AA seqDB search
MTARPKLVIGANGFLGSHVTRQLVAKGHEVRAMVRENANTRSIDDLELTRFHGDVFDTAV
LREAMDGVDDVYYCVVDTRAWLRDTSPLFRTNVEGLRNVLDVAVAQPDLRRFVFTSTYAT
VGRRRGRVATEDDIVATRGLSDYVQSRVQAENLVMRYVAESGLPAVAMCVSTTYGSGDWG
RTPHGAFIAGAVFGKLPFTMDGIQLEVVGVTDAAEAMLLAAERGRVGERYLISERMIALT
EVVRIAADEAGVPPPRRSIPVPVLYALGALGSLRARLTGKDAELSLASVRMMRAEAPVDH
SKAVRELGWQPRPVEESIREAARFWAAMRNAKGKSATPR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgccaggcccaaactcgtcatcggcgccaacggcttcctgggttcgcacgtcacg
cgccagctggtcgccaagggccatgaagtgcgggccatggtgcgcgagaacgccaacacc
cggtccatcgacgacctcgagctcacccggtttcacggtgacgtgttcgacaccgccgtg
ctgcgggaggccatggacggggtcgacgacgtctactactgcgtcgtcgacacccgcgcc
tggctgcgcgacacctcgccgctgtttcgcaccaacgtcgaggggctgcgcaacgtcctc
gacgtggccgtcgcgcaacccgacctgcgtcggttcgtcttcaccagcacctacgcgacg
gtcggccggcggcgcgggcgcgtggcgaccgaggacgacatcgtcgccacccgcgggttg
tcggactacgtccaatcccgggtccaggccgagaacctggtgatgcgctacgtggccgaa
tccgggctgcccgcggtggcgatgtgcgtgtcgacgacctacggcagcggcgactggggc
cgcaccccgcacggcgcgttcatcgccggcgccgtcttcggcaagttgcccttcaccatg
gacggcatccaattggaggtcgtcggcgtcaccgacgccgcggaggccatgctgttggcc
gccgagcgcggccgcgtcggcgagcgatacctgatctccgagcgaatgatcgcgttgacc
gaggtggtgcggatcgcggccgacgaggccggcgtgccgccgccgcgacgttccatcccc
gttccggtgctgtacgccctcggcgccctgggcagcctgcgagcccggctcaccggcaag
gacgccgagctcagcctcgcgtcggtgcgcatgatgcgtgccgaggcgcccgtcgaccac
agcaaggccgtccgcgaattgggttggcagccacgcccggtcgaggagtccatccgcgag
gcggcccgattctgggccgccatgcgaaatgccaagggtaagagcgcgactccccgctga

DBGET integrated database retrieval system