KEGG   Micromonas sp. RCC299: MICPUN_105588Help
Entry
MICPUN_105588     CDS       T02695                                 

Definition
hypothetical protein
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
mis  Micromonas sp. RCC299
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5:complement(join(761623..762511,762601..762725))
Genome map
AA seq 337 aa AA seqDB search
MEWTTIESDPGVFTELIQEMGVKGVQVEELYSLDEGSLRAMAPVYGLIFLFKYRSGEAPS
APVETDASSSGVFFASQVITNACATQAILSILMNCPASVQLGEELGNMKAFTAEFDADLK
GLAISNSETIRKAHNSFARPEPIMEEQRDQAPSDDVFHFIAYMPVNGRLYELDGLKRGPI
AHGECTDDDWLGKVCPVIQSRIEQYASSEIRFNLMALIKSPKQALEERLAKIEARKERCA
KVAAGAAVDAGMDVDGGDDLDGPLPSGQDAVAAELARLEGEAAVAREGIEREAQKAQRWR
DENIRRKHNYIPFIFNFLKVLAEKKKLEPLIAKARGQ
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggagtggacgaccatagagagtgaccccggggtcttcacggagctcatccaggagatg
ggcgtgaagggcgtccaggttgaagagctctacagcctcgacgagggctcgctgagggcg
atggcgcccgtgtacggactcatttttctgttcaagtaccgcagcggcgaggcgcccagc
gcacctgtggagaccgatgcgagctccagcggggtcttcttcgccagccaggtgatcacg
aacgcgtgcgccacgcaggcaatcctctcgatcctgatgaactgcccggcgtccgtccag
ctcggcgaggagctgggaaacatgaaggcgttcaccgcggagttcgacgccgatctgaag
ggtctcgccatcagtaacagcgagaccatccgcaaggcgcacaactccttcgcccggccc
gagcccatcatggaggagcagagggaccaggccccatccgacgatgtctttcacttcatc
gcgtacatgcccgtcaacggacgactctacgagctcgacggcctgaagcgcggccccatc
gcccacggcgagtgcaccgacgacgactggctcgggaaggtgtgcccggtgatccaatcg
cgtatcgaacagtacgcgagctccgaaatccgcttcaacctcatggcgctcatcaagtcc
cccaagcaggcgctcgaggagagactcgcgaagatcgaggcgaggaaggagaggtgcgcg
aaagtcgcggcgggcgcggcggtggacgctggcatggatgtcgacggcggcgacgacctc
gacggccccttaccctcggggcaggacgccgtcgcggcggagctggcgcggctcgagggc
gaagcggcggttgccagggagggcatcgagcgggaggcgcagaaggcgcagcggtggagg
gacgagaacatccgacgcaagcacaactacatcccgttcatattcaactttctgaaggtg
ctcgcggagaagaagaagctcgagccgctcatcgccaaggccaggggccagtaa

DBGET integrated database retrieval system