KEGG   Micromonas sp. RCC299: MICPUN_106515Help
Entry
MICPUN_106515     CDS       T02695                                 

Definition
histone acetyltransferase
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
mis  Micromonas sp. RCC299
Brite
Enzymes [BR:mis01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MICPUN_106515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
14:complement(join(607963..609249,609446..609496))
Genome map
AA seq 445 aa AA seqDB search
MAAAEDTKKDADVKATKAEKEDPKADDGDAKDDKKTADAAKKPPEDDVIKKVVDGVGIPL
DIGARVQCKWRDGQMYPVRVIERRAGPKGKEAQEEYEYYVHYEQFNRRLDTWVTIAEMDL
ATAEQDEPGKKRKHEDAHDEEHAEFDPNALREHEEVTKVRNILKVELGRHEMDTWYFSPF
PPEYTTCKKLFFCEFTLNFFKRKEQLQRHLRKTEMYHPPGDEIYRNESRGKTTAFFEIDG
KKEKIFCQNLCYLAKLFLDHKTLYYDVDLFLFYVLCEVDERGYHIVGYFSKEKCSEEGYN
LACILTLPAYQRKGYGKMLISFSYELSKKEGKVGTPERPLSDLGLVSYRGYWTRELLAIL
KDESRAVMSIKDLSELTMIKTEDIISTLQHLNLLAYQKGAYVICAAPELIEKHLKAAGSP
GVEVDPTKLIWTPYNAEKEYANFRG
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgccgaggacaccaagaaggatgccgacgtcaaggcgaccaaggccgagaag
gaggacccgaaggctgacgacggcgacgccaaggacgacaagaagaccgccgacgccgcc
aagaagccccccgaggacgacgtcatcaagaaagtcgtggacggcgtcggcatccccctc
gacatcggcgcgagggtccagtgcaagtggcgcgacggccagatgtaccccgtccgggtc
atcgagcgccgagcgggacccaagggcaaggaggcgcaggaggagtacgagtactacgtc
cactacgagcagttcaaccggcgcctggacacctgggtcaccatcgccgagatggacctc
gcaacggcggagcaggacgagcccgggaagaaacggaagcacgaggacgcgcacgacgag
gagcacgccgagttcgaccccaacgcgctgcgggagcacgaggaggtgaccaaggtgaga
aacatcctgaaagtcgagctcgggaggcacgagatggacacgtggtacttttcgccgttt
ccgcccgagtacaccacgtgcaagaagctgttcttctgcgagtttaccctcaacttcttc
aagcggaaggagcagctgcagaggcaccttcggaagacggagatgtaccacccgcccggg
gacgagatctaccgcaacgagtcgaggggtaagactacggcgtttttcgagattgacggc
aagaaggagaagatcttctgccagaacctgtgctacctcgccaagctcttcctggaccac
aagacgctctactacgacgtggacctgttcctgttctacgtgctgtgcgaggtggacgag
cgcgggtaccacatcgtcgggtacttcagcaaggagaagtgctccgaggagggatacaac
ctggcgtgcatcctgacgctgccggcgtaccagcgcaaggggtacgggaagatgctcatc
tccttctcgtacgagctgagcaagaaggagggcaaggtcgggaccccggagcgaccgttg
tcggacctcgggctggtgtcgtaccgcggctactggacgagggagctcctcgcgatcctc
aaggatgaatccagggcggtgatgagcatcaaggacctgtccgagctcacgatgatcaag
acggaggacatcatcagcaccctgcagcacctcaacctgctggcgtatcagaagggcgcg
tacgtcatctgcgccgcgcccgagctcatcgagaagcacctcaaggcggcgggatcgccg
ggcgtggaggttgacccgacgaagctcatctggaccccgtacaacgccgagaaggagtac
gcaaacttccgcggatga

DBGET integrated database retrieval system