KEGG   Micromonas sp. RCC299: MICPUN_107354Help
Entry
MICPUN_107354     CDS       T02695                                 

Gene name
MAPK
Definition
hypothetical protein
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
mis  Micromonas sp. RCC299
Brite
Enzymes [BR:mis01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     MICPUN_107354 (MAPK)
Protein kinases [BR:mis01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   MICPUN_107354 (MAPK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(join(1398619..1398669,1398723..1398962,1399018..1399122,1399183..1399237,1399288..1399383,1399440..1399570,1399630..1399739,1399790..1399869,1399938..1400095,1400154..1400219))
Genome map
AA seq 363 aa AA seqDB search
MSEEIDKHVLRKYEIQQKLGKGAYGIVWKSVDKKTRDVVAVKKIFDAFQNATDAQRTFRE
IMFLQEVNNHENIVRLLNVLKAENDRDIYLIFEYMETDLHAVIRANILEDIHKQYIMYQL
FKALKYMHSAELLHRDVKPSNLLLNSECQMKIADFGLARSLTNIADNKDSTPILTDYVAT
RWYRAPEILLGSTRYTFGVDTWSSGCILGELLGGKPIFPGTSTMNQLDRIIEVTGKPANE
DIVAVQSPFAITMLASLPPPKPKKATELFPRASHQAADLLQKLLQFNPEKRITAEEALRH
PYLAQFHNPADEPYCDHRILIPVDDNTKYSVQEYRETLYSEIVKRKKELRRRMREREQAR
AIR
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagagatcgacaagcacgttctgcgaaaatacgaaatacagcagaagctcggg
aaaggggcatacggaatagtttggaaatctgtggacaagaagacccgtgatgttgtagcc
gtgaaaaaaatctttgacgcgttccaaaacgctacagatgcacagcgaacgtttcgcgaa
attatgtttctgcaagaggtcaacaaccacgagaatattgtcaggttgttgaatgttctg
aaagcagaaaacgacagagacatctatctgatttttgagtacatggaaactgacttgcat
gcagtaatacgcgcaaatattttggaggacatccataaacaatacatcatgtaccaactt
ttcaaggcactaaaatacatgcattccgctgagctcttgcacagggatgtcaagccaagc
aatctactattaaacagtgaatgtcaaatgaagatagcagactttgggctcgctcgctct
ttaacgaatattgcggataacaaagattctacgcctatattaacggattatgtagcaacg
cgctggtatcgagcccctgagattcttctgggttctacaagatacacatttggagtcgat
acatggtcaagtggttgtatcctcggagaacttcttggaggaaagccaattttccctggc
acctcgaccatgaatcaacttgaccgcataattgaggttacgggaaaacccgcgaacgaa
gacattgtcgccgtgcaatctccattcgcaatcacgatgcttgcatctcttccgccccca
aagccaaagaaagctacagagctttttccacgcgcgagtcaccaggctgcagatttgttg
caaaagctcctccaattcaatcccgagaaacgaatcacggcagaggaagcgttgagacat
ccatacttagctcagttccataatccagcagatgagccatactgtgatcaccgtattttg
attcccgtcgacgacaataccaaatactcagttcaagaataccgagaaacgctttactct
gaaattgttaagaggaagaaggagttgcgtcgacgaatgcgcgagcgtgagcaagctagg
gcaattcgataa

DBGET integrated database retrieval system