KEGG   Micromonas sp. RCC299: MICPUN_108102Help
Entry
MICPUN_108102     CDS       T02695                                 

Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
mis  Micromonas sp. RCC299
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mis00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    MICPUN_108102
Enzymes [BR:mis01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     MICPUN_108102
Exosome [BR:mis04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   MICPUN_108102
  Exosomal proteins of colorectal cancer cells
   MICPUN_108102
  Exosomal proteins of bladder cancer cells
   MICPUN_108102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4:complement(784909..785451)
Genome map
AA seq 180 aa AA seqDB search
MKYFGVSPDLLPAVVLHETETDKKYILHRAEPKGIAPWLAKYDVGSLDPSFKSEEPPNSN
DGAVKVIVASTFEALVTGSKANVLIEFYAPWCGHCKKFAPVMEKVGHKFASNDAVVIAKM
DATANDVLDKRFIVKAYPTLYFYQAKTDKVILYDGDRSEMHLIGFVMKHSGKTVSHKEDL
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgaaatactttggggtttcccctgatctccttccagctgttgtgttgcacgaaacagag
accgacaagaaatacatcctgcatcgagcagagccgaaagggattgccccgtggctcgcg
aagtacgatgtcggctctcttgacccgtccttcaagagtgaggaaccgcccaactcaaat
gacggcgcagtcaaagtcatcgtcgcgagtacgtttgaggcattggtcacggggtcaaaa
gctaacgtgttgatcgaattttacgcaccatggtgtggtcattgtaagaaattcgcacct
gtgatggagaaagtgggtcataagtttgcctccaatgatgccgttgtgattgcaaagatg
gacgcaactgccaacgatgttttggacaaaaggtttatagtcaaggcgtatccaactttg
tatttctatcaggcaaagacggacaaggtgattctctacgacggcgacagaagcgaaatg
cacctcattgggttcgtgatgaagcattctggtaaaacagtttcacataaggaagatctt
tag

DBGET integrated database retrieval system