KEGG   Micromonas sp. RCC299: MICPUN_108998Help
Entry
MICPUN_108998     CDS       T02695                                 

Definition
hypothetical protein
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
mis  Micromonas sp. RCC299
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mis00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    MICPUN_108998
Enzymes [BR:mis01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     MICPUN_108998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
10:complement(303858..305300)
Genome map
AA seq 480 aa AA seqDB search
MPAQTRGARRKSLGLPPKEKQERFDPSSPSKAKTGKKAEGWGAPERTGFWANVYGTCGVL
AIIGTTPFIAVIVWHMFVNLDGSLASIVAAFQKDGLSLIAKIWPWTSKRAWQLLGSYAAF
EALLQVYMPGKRFEANPTAAGNVPVYKANGVQSLVATVIAFFLCWHLGLTTPLEVYSLFG
EMLAGMSLLAIVFCVFLLVKGHVAPTDEDSGSCGNVVYDFWWGMELYPKIGPLNLKQFTN
CRFGMMAWAILPIIFACHQYQRDGFLADSVAVCVALMCVYNFKFFVWETGYFNSMDIQHD
RAGYYICWGCLVWVPAVYASPALYIASVQPPVNLGPRLAAAIFALGCLSIWINYDSDRQR
QEFRASGGKKKVWGKKPVIVEAEYKVAKDGRTVTKKSILLASGWWAIARHFHYLPEISAS
FFWTAPALFGKLPPYLYVIFLTVLLIDRSMRDDTRCSLKYGKYWKKYCELVPYKIVPGIF
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcgcagacacgcggcgccaggcgcaagtcactcgggctcccgcccaaggaaaag
caggagcgcttcgacccgtcctcgccgtccaaggcgaagactggcaagaaggccgagggc
tggggcgcccccgagcgcaccggcttctgggcgaacgtctacggcacgtgcggcgtgctc
gccatcatcggcaccaccccgttcatcgcggtcatcgtctggcacatgttcgtcaacctc
gacggctcgctcgcctccatcgtcgccgcctttcagaaggacggcctctcgttgatcgcc
aagatctggccgtggacctccaagcgcgcgtggcagctcctcggatcctacgccgccttc
gaggccctcctccaggtgtacatgccgggtaagaggttcgaggcgaaccccaccgcggcg
ggcaacgttccggtgtacaaggccaacggcgtccagtccctcgtcgccacggtgatcgcc
ttcttcctctgctggcacctcggcttgaccaccccgctcgaggtgtactcgctcttcgga
gagatgctcgcgggtatgtccttactcgcgatcgtcttctgcgttttcctgctcgtcaag
ggccacgtcgcgcccaccgacgaggacagcggctcgtgcggcaacgtcgtgtacgatttc
tggtggggcatggagctctatccgaagatcggcccgctgaacctcaagcagttcaccaac
tgcaggttcggcatgatggcgtgggcgatcctcccgatcatcttcgcgtgccaccagtac
cagcgcgacggtttcctcgccgactccgtcgccgtgtgcgtcgcgctcatgtgcgtgtac
aacttcaagtttttcgtctgggagactggatacttcaacagcatggacatccagcacgac
cgcgcggggtactacatctgctggggatgcctcgtgtgggttcccgcggtgtacgcgtcc
cccgcgctgtacatcgcgtcggttcagcccccggttaacctgggcccgcggctggcggcg
gcgatcttcgcgctcggctgcctctccatctggatcaactacgactcggaccgccagcgt
caggagttccgagccagcggcggcaagaagaaggtgtggggcaagaagcccgtcatcgtg
gaggctgagtacaaggtggcgaaggacggaaggaccgtgacgaagaagagcatcctgctc
gcgtctggctggtgggcaatcgccaggcactttcactaccttccggagatctccgcgtcg
ttcttctggaccgcgcccgcgctcttcggcaagctcccgccttacctttacgtcatcttc
ctcaccgtgcttctgatcgaccggagcatgagggatgacacgagatgctcgctcaagtac
ggcaagtactggaaaaagtactgcgagctcgtgccgtacaagatcgtcccggggatcttc
taa

DBGET integrated database retrieval system