KEGG   Micromonas sp. RCC299: MICPUN_51374Help
Entry
MICPUN_51374      CDS       T02695                                 

Gene name
SBE2A
Definition
glycoside hydrolase family 13 protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mis  Micromonas sp. RCC299
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mis00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MICPUN_51374 (SBE2A)
Enzymes [BR:mis01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     MICPUN_51374 (SBE2A)
Exosome [BR:mis04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MICPUN_51374 (SBE2A)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(662068..664554)
Genome map
AA seq 828 aa AA seqDB search
MPSSTPAPAPPPVPPSAAAPQPPSPPAPAPSASIEYAPSPEAPVGAAAPPPQEQNNFMAA
AGGGANRPPTGGPAAARPGGRLDPKQIKDFQPVTPTRANTKPIYGAEIKPIDEPKHRFDN
FQYPPITDDGWGITALDGTLNQYRDHLGYRWSKYCGLRNAIDQNEGGMEKFSRGYEVMGF
TRNEQGITYREWAPGAKAACLFGDFNGWSTGAEGVWMTKNDYGVFEVFLPNLADGSPAIP
HGTRVKVHLEVEGQEPVDKIPAWIKFAVQAPDEIPFNGIYYDPPPEEVYQFKYARPKSPD
ELRIYEAHVGMSSIEPKINSYVEFADDVIPRIAQLGYNAVQLMAVQEHAYYASFGYHVTN
FFAVSSRCGTPDELKYLIDTAHSYGVAVLMDIVHSHASSNATDGINMFDGTNGQYFHDGP
QGYHWMWDSRCFNYGSWEVLRFLLSNLRYWMEEFKFDGFRFDGVTSMMYSHHGLQMAFTG
DYGEYFGMSTDVDAMVYLMLANDMLHTLYAGNCVTIAEDVSGMPTLARPVSEGGVGFDYR
LQMAIADKWVEVLSEWGMDDAWDMGNLVHTLENRRWGEKCVSYAESHDQALVGDKTTAFW
LMDAAMYTDMSTLTPDTPVITRGIALHKMIRQLTMCLGGEGYLNFMGNEFGHPEWIDFPR
GDRIEASTGEFVPGNGNSYHLCRRRFDLADMDHLRYKYLNAFDTAMNDVAARFKYLCSDH
QYTSLKCNNDKMIVVERGECVFVFNFHPVNSYEGYRIGLKHGGPWKLVLSSDNPEMGGYS
NLWTYTCPEIMSEEWDFNNRPASMCVYAPARSVSVYAPSESVRMKYGA
NT seq 2487 nt NT seq  +upstreamnt  +downstreamnt
atgccttcctccacacccgcgcctgcaccacctcctgtgcctccttcagcggctgcacct
caaccaccctctcctcctgcaccggcgccttcagcaagcattgagtatgctccttctcct
gaggcgcctgttggagccgctgcacctcctccccaggaacaaaacaattttatggcggca
gccggcggaggtgcgaatcgccctccaactggtggcccagccgcggcccgccctggtggg
cgacttgacccaaagcagataaaagactttcagccggtgaccccaaccagggcgaacacc
aaacctatttacggggctgaaatcaaaccaatcgacgagccgaagcatcgctttgataat
tttcaatatccccccatcaccgatgatggttggggcatcaccgcactcgacggaacactt
aatcagtaccgcgaccatctcggctatcgctggtcaaagtattgtgggttgcgaaatgca
attgaccaaaacgagggaggaatggaaaaattttctcgaggatacgaagtcatgggtttc
acccgaaacgagcaaggtattacctatcgcgagtgggcgcccggcgcgaaggcagcgtgc
ctttttggtgacttcaacggttggtctaccggagctgagggtgtttggatgaccaagaat
gactacggcgtgttcgaggtgttcctacctaaccttgcggatggttctcccgcaattccc
cacggcacacgcgtcaaggtgcatctggaagttgaaggccaggaacctgttgacaagatt
cccgcgtggataaaatttgctgttcaggcaccagatgagattcctttcaatgggatatat
tacgacccgccacccgaggaagtgtatcagttcaagtatgcacggcccaagagcccggac
gagctccgaatctatgaagcgcacgttggcatgtcgtcaatcgaaccaaagataaattct
tacgtagagttcgccgacgacgtcatcccccgtattgcgcagctagggtacaacgccgtg
cagctgatggctgtacaagaacacgcatattatgcatcttttggataccacgtcaccaat
tttttcgccgtgtcatctcgttgtggcacgccagatgagctcaaatacttgattgatacg
gcacattcttacggcgttgccgttcttatggatatcgtccactctcatgcgtcttccaat
gccactgatggaataaacatgttcgacggaactaacgggcagtatttccacgacggtcca
caagggtatcactggatgtgggactcgcgctgtttcaactatggcagctgggaagtattg
cgcttcctgctctccaatctcaggtattggatggaagagttcaaattcgatggtttccgt
ttcgacggcgtgacctcgatgatgtactcgcaccacggcctgcagatggccttcacaggg
gattacggtgagtatttcggcatgtcaacggacgtagatgctatggtttatctcatgctg
gctaatgatatgctccacaccctttatgctgggaactgtgtcaccatcgctgaagatgtt
tcaggcatgccaaccctcgctcgacccgtgagtgaaggtggtgttgggtttgactatcgc
ttgcagatggcgattgcagacaagtgggtcgaggttttaagtgagtggggcatggatgac
gcatgggatatgggtaacctcgttcacactcttgagaatcgaaggtggggtgaaaaatgc
gtttcatatgccgaatcccatgaccaggcgctagtcggcgacaagaccactgcgttttgg
ctcatggatgcggccatgtacacagacatgtccactttaacaccggatactccagtcata
actcgcggaatagctctgcacaaaatgattcgccagctcaccatgtgtctcggtggagaa
ggatacctgaatttcatgggaaatgaattcggacatccagagtggattgacttcccccgc
ggcgatcgaatcgaggcttcgaccggggaatttgtcccagggaacggaaattcataccat
ctctgccgccgacgctttgatttggcagatatggaccatctcaggtacaagtacctcaac
gcgttcgacacagcgatgaatgacgtggcggcgaggttcaaatatctttgctcagaccac
caatacaccagcttgaagtgcaacaacgataagatgattgttgtcgagcgaggcgaatgc
gtgttcgtattcaattttcacccggtaaactcttatgaaggttatcgaattggcctaaag
cacggtggcccctggaagctcgttctatcttcagacaacccagagatgggaggttactca
aatctttggacatacacgtgcccagaaataatgtcagaagagtgggactttaacaatcga
cccgcatctatgtgtgtttacgcacccgcacgatccgtgtctgtttacgcaccctcggag
agtgtccggatgaaatatggtgcgtga

DBGET integrated database retrieval system