KEGG   Micromonas sp. RCC299: MICPUN_51586Help
Entry
MICPUN_51586      CDS       T02695                                 

Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
mis  Micromonas sp. RCC299
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:mis00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    MICPUN_51586
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    MICPUN_51586
Enzymes [BR:mis01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     MICPUN_51586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:join(1145452..1145892,1145959..1147170)
Genome map
AA seq 550 aa AA seqDB search
MNDPLSHYFINSSHNTYLHGHQLFSNPSAAAIKRALLHGCRVIELDCYDGGRNGPIVMHG
RTATSPITFRNAIRIINEFSHAMSNYPVLITLENNCSHWKCSELAQILLEELGEKLFVPP
EEVRESWLSPAALRGKILIRSKLKYREESRVNSSCWCSSSSGKNTANTDCAAHLKLLAWD
RSAVDAVQKIIDRCFPVCGAQNVRSCALSPSDETNTSATSATEFSSLVYVENVKLPTPHQ
STSLKSLHSCSWSESKLVSQVEEIGRELIAGFAKRHMLRCYPSAKRITSDNYDPSLAWSV
GAQMAALNFQADDISMWINRGKFLANGGCGFVRKPEYLIGSKLGPPNVPACTLNITVVAC
SGWTTFERFHSYETPTTYIRVSLAGSILDNKSCVTSAFSKRKQFGPYAQPFFNETFSFDI
FEPRLSTLLFSVHAKESTAHDAFVAQSCFPVTLLRPGTRLVPLYDQYGKYVGEAGPLCAR
DLFLHMLLFHVLSEIVSTDSWTSSSILPRFLDSCNAPRRCHGLHHFVTLVLGGQGKTACM
VVKIKILDSV
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatccgctatcgcattatttcatcaacagctctcacaatacatatttgcatggg
caccagcttttttcaaacccttctgcagcagctatcaagcgcgccctgctgcatggctgc
cgggtgatagagctagactgctatgacggtgggaggaatggcccaatagtcatgcatggt
cgtactgcaacatccccgatcacgtttcgaaatgcaatcaggatcattaacgagttttcc
catgcaatgtctaattacccagtgctgatcaccctggagaataattgcagccactggaag
tgctccgaattggcgcaaatacttcttgaagaacttggagaaaagctttttgttcctcca
gaagaagtcagggaatcatggctgtccccagctgcgcttcgaggaaagattttgattcgc
agcaaactcaaatatcgtgaggaaagtcgtgtgaattcctcgtgctggtgttcgagtagt
tctgggaaaaacaccgcaaatacagactgcgcggcgcaccttaaattgctagcttgggat
cgttcagcagtagatgctgttcagaaaattatagatcggtgctttccagtatgcggggca
caaaacgtgcgttcctgcgcactttctccatcagatgaaacaaatacttcggcaacctcg
gcaacagagttttcctcactggtgtacgtcgaaaatgtgaagttgccaactccccatcag
tccacttcactgaaatcactgcactcctgctcatggagcgaatcaaagcttgtgagtcaa
gttgaagaaattggtagggagctgattgccggatttgcaaagcggcatatgttgaggtgc
tacccatctgcaaaaagaatcacgtcagataattacgacccgtctcttgcatggtctgtc
ggagcgcagatggctgccctgaactttcaggctgatgacatttcgatgtggataaaccgg
ggtaagtttctggcaaacgggggttgcgggtttgtacgaaagccagaatatctcatcggc
tccaagcttggtccaccaaatgttcctgcttgtacgctcaatatcactgtcgtggcctgt
tctggctggaccactttcgaaagattccactcgtacgaaacaccaacgacctacattcga
gttagtttggctggaagcattctggacaataaatcgtgtgtaacttctgccttcagcaaa
cgcaaacagttcggaccttacgcgcagccatttttcaacgagaccttttcgtttgatatt
tttgagccaagactttcgacgcttctattttctgtacatgctaaggaatctactgcacac
gatgctttcgtagcacagagctgtttccctgtaaccttacttcgtccaggcacacgactt
gtacctttgtatgatcagtacggcaagtacgttggtgaggccggtccgctgtgcgcgcgt
gacctatttcttcatatgctattgttccacgtcttatccgagatagtctctactgattct
tggacttcttcttccatccttcctcgctttttggattcctgcaatgctccgaggcgttgt
catggtctgcaccattttgtgaccctggttcttggtggtcaaggaaaaaccgcttgcatg
gtcgtcaaaataaaaatattggattccgtttag

DBGET integrated database retrieval system