KEGG   Micromonas sp. RCC299: MICPUN_51586Help
Entry
MICPUN_51586      CDS       T02695                                 

Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
mis  Micromonas sp. RCC299
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:mis00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:mis04070]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:join(1145452..1145892,1145959..1147170)
Genome map
AA seq 550 aa AA seqDB search
MNDPLSHYFINSSHNTYLHGHQLFSNPSAAAIKRALLHGCRVIELDCYDGGRNGPIVMHG
RTATSPITFRNAIRIINEFSHAMSNYPVLITLENNCSHWKCSELAQILLEELGEKLFVPP
EEVRESWLSPAALRGKILIRSKLKYREESRVNSSCWCSSSSGKNTANTDCAAHLKLLAWD
RSAVDAVQKIIDRCFPVCGAQNVRSCALSPSDETNTSATSATEFSSLVYVENVKLPTPHQ
STSLKSLHSCSWSESKLVSQVEEIGRELIAGFAKRHMLRCYPSAKRITSDNYDPSLAWSV
GAQMAALNFQADDISMWINRGKFLANGGCGFVRKPEYLIGSKLGPPNVPACTLNITVVAC
SGWTTFERFHSYETPTTYIRVSLAGSILDNKSCVTSAFSKRKQFGPYAQPFFNETFSFDI
FEPRLSTLLFSVHAKESTAHDAFVAQSCFPVTLLRPGTRLVPLYDQYGKYVGEAGPLCAR
DLFLHMLLFHVLSEIVSTDSWTSSSILPRFLDSCNAPRRCHGLHHFVTLVLGGQGKTACM
VVKIKILDSV
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatccgctatcgcattatttcatcaacagctctcacaatacatatttgcatggg
caccagcttttttcaaacccttctgcagcagctatcaagcgcgccctgctgcatggctgc
cgggtgatagagctagactgctatgacggtgggaggaatggcccaatagtcatgcatggt
cgtactgcaacatccccgatcacgtttcgaaatgcaatcaggatcattaacgagttttcc
catgcaatgtctaattacccagtgctgatcaccctggagaataattgcagccactggaag
tgctccgaattggcgcaaatacttcttgaagaacttggagaaaagctttttgttcctcca
gaagaagtcagggaatcatggctgtccccagctgcgcttcgaggaaagattttgattcgc
agcaaactcaaatatcgtgaggaaagtcgtgtgaattcctcgtgctggtgttcgagtagt
tctgggaaaaacaccgcaaatacagactgcgcggcgcaccttaaattgctagcttgggat
cgttcagcagtagatgctgttcagaaaattatagatcggtgctttccagtatgcggggca
caaaacgtgcgttcctgcgcactttctccatcagatgaaacaaatacttcggcaacctcg
gcaacagagttttcctcactggtgtacgtcgaaaatgtgaagttgccaactccccatcag
tccacttcactgaaatcactgcactcctgctcatggagcgaatcaaagcttgtgagtcaa
gttgaagaaattggtagggagctgattgccggatttgcaaagcggcatatgttgaggtgc
tacccatctgcaaaaagaatcacgtcagataattacgacccgtctcttgcatggtctgtc
ggagcgcagatggctgccctgaactttcaggctgatgacatttcgatgtggataaaccgg
ggtaagtttctggcaaacgggggttgcgggtttgtacgaaagccagaatatctcatcggc
tccaagcttggtccaccaaatgttcctgcttgtacgctcaatatcactgtcgtggcctgt
tctggctggaccactttcgaaagattccactcgtacgaaacaccaacgacctacattcga
gttagtttggctggaagcattctggacaataaatcgtgtgtaacttctgccttcagcaaa
cgcaaacagttcggaccttacgcgcagccatttttcaacgagaccttttcgtttgatatt
tttgagccaagactttcgacgcttctattttctgtacatgctaaggaatctactgcacac
gatgctttcgtagcacagagctgtttccctgtaaccttacttcgtccaggcacacgactt
gtacctttgtatgatcagtacggcaagtacgttggtgaggccggtccgctgtgcgcgcgt
gacctatttcttcatatgctattgttccacgtcttatccgagatagtctctactgattct
tggacttcttcttccatccttcctcgctttttggattcctgcaatgctccgaggcgttgt
catggtctgcaccattttgtgaccctggttcttggtggtcaaggaaaaaccgcttgcatg
gtcgtcaaaataaaaatattggattccgtttag

DBGET integrated database retrieval system