KEGG   Micromonas sp. RCC299: MICPUN_51821Help
Entry
MICPUN_51821      CDS       T02695                                 

Definition
hypothetical protein
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
mis  Micromonas sp. RCC299
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mis00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MICPUN_51821
Enzymes [BR:mis01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     MICPUN_51821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1657526..1658191
Genome map
AA seq 221 aa AA seqDB search
MSKGLTTPVAKLSQCCLKKSKRSFPGLSSTRRGEIHMIIGPMFSGKSTALIQRVKEDEAA
GLQAQMVNSSRDVRYSSFEVVSHGGATRPCHCIEKLWDIPILLGFEHFSRVDVLAIDEAQ
FFPDLASFCISAAEDHHKKVIVAGLSGDFRRKRFGQISDLIPIADSVLKLTSNCAMCDMT
SGLFSLRTTSNWENQELIGGPDSYKPVCRSCYTSAWAEQTT
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaggggcttacaactccggtagccaagttatcgcagtgttgcttgaagaaatcg
aagcgcagctttccgggcttgtccagcacccggcgaggtgaaatccacatgattatcgga
ccaatgttttcaggcaagtcgactgccctaattcaacgagtcaaagaagacgaggctgct
ggattacaagctcagatggtaaattcatcaagagatgtgagatactcgagcttcgaggtc
gtctcacacggcggcgctacccgtccgtgtcactgcatcgagaaactttgggacatccca
atccttcttggttttgaacatttttctagagtcgatgtgttggcgatcgacgaggctcaa
ttctttccagatctcgcatctttttgcatatctgctgccgaggaccatcacaagaaagta
atcgtcgctggactgagtggagattttcgtcggaaaaggtttgggcagatttcagatcta
attccaatagctgactccgttttaaagcttacctccaactgtgccatgtgtgatatgacc
agtgggttattctcgctccgcacgacatcaaattgggaaaatcaagagttaattggcggc
cctgattcatacaagcccgtatgcaggagttgttatacaagcgcgtgggcagagcaaaca
acctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system