KEGG   Micromonas sp. RCC299: MICPUN_55788Help
Entry
MICPUN_55788      CDS       T02695                                 

Definition
hypothetical protein
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
mis  Micromonas sp. RCC299
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mis00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    MICPUN_55788
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    MICPUN_55788
Enzymes [BR:mis01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     MICPUN_55788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(1527474..1530338)
Genome map
AA seq 954 aa AA seqDB search
MRGAWRLPALLVLLVVGAGGYPTPDDNLGPPLGVAWTHAMGGPAAGERTRPRVPCVDDGP
VAGAPIGGMGAGTMGRTYRGDFARWHMRVGGHTHRPAAHTLFAARVDGTATVLSALPSHA
VMEGVPGGGGSDRTHSRRVLPPDGTGGTYHALYPRSWYEYDPSALAPGGRVRLSQTQFSP
VIPGEYRDASMPVGVFRFLASNEGDVPADVALAFSFENVLATTDVAPVDVGPPRGAWRLA
PHELTHSTFERSGGRVAGVHMHTDDVVYGTRSPSEPWHGGIAVAVGGNGELGGLNVTTLP
LYDAGDADSIESKFWRPFERAGGFGRDESAAANEHDGGLPAGPLSACAVSAAFTLAPGER
RNVTFAAAWDLPASSFPRGVRWAKRYTRYHGSFIHRRDVPRGAAAPDIATEALLRADEWE
GDIARWQRGFVQSAAAKDANLDDPAGGRGRNYPGRVRDRPTLRRPAWLVGAMFNELYYLV
DGGTLWGRPLTVAGLEGDVEESEASAAAPGGWRGEDGEGGDAQDVAGNGGEWGGTLGRFG
LLESFDAPVYNALDVHFYGSWPLAMLWPGLDLAVLADLAAGVDSEDDEERALSWNARDAG
RAPEMRKRKVRGSAPRDLGAPFDAPLTSSPNAFDLTDVNRWKDLAPKLMLTLARAHALRG
GFRGPNDPGGIPRDVLRRMFRPCYESLAAQLRRFDGNGDGLIEHDDDDEAGPDHSFVAWR
ARGDTSAYAGGLWLAALRAGAGLARDLNETHARDSLEQTMRAAAVAHDAALWLGDDDGGR
GYYRFDASGTEGGDVSSAAQVMGEWALAVIGARGVLPARKVRAALASVARLNVAAAGGAG
GAVNGAAASGSVDAVSAHSNEVWPGVSYAVASHMLLAGMDDEAWELARGVAAGTYERGLA
FRTPEAWDARGGFRSAMSQRAGSVWAIEHALTLRHRREVAAWEKAGRGRVKDEL
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgcggggcgcctggcgcctcccggcgctgctggtgctcctcgtcgtcggcgcggggggc
tatccaacacccgatgataacctcggaccgcccctcggcgtggcttggacacacgcgatg
ggcggacccgcggctggcgagcgcaccagaccgagggtgccgtgtgtcgacgacgggccc
gtggctggcgcgcccatcgggggcatgggcgcggggacgatgggcaggacgtatcgcggg
gacttcgcgaggtggcacatgcgcgtcggtggtcacacgcacaggcccgcggcgcacacc
ctgttcgccgcgcgcgtcgacggcaccgccaccgtgctctccgcgctgccgtcgcacgcg
gtgatggaaggcgtgcccggcggcgggggctcggaccggacccactcgcgtcgcgtcctc
cccccggacggcaccggcgggacctaccacgcgctctacccgcggtcgtggtacgagtac
gacccgtccgcgctcgcccccgggggccgggttcggctgtcgcagacgcaattctcgccg
gtcatccccggcgagtaccgcgacgcgtcgatgcccgtcggcgtctttcgcttcctcgcg
tcgaacgaaggcgacgttcccgcggacgtcgcgctggcgttcagcttcgagaacgtcctc
gccaccacggacgtggcgccggtggacgtcggtcccccgcgaggcgcgtggaggctcgcg
ccgcacgagctgacgcactcgacgtttgagcgatcggggggccgcgtcgcgggggttcac
atgcacacggacgacgtggtgtacggcacccgatcgccctcggagccgtggcacgggggg
atcgcggtggcggtcggcgggaacggcgaacttggggggctgaacgtgacgacgcttccg
ctgtacgacgcgggcgacgcggattcgatcgagtcaaagttctggcgcccttttgagcga
gcgggcggtttcggtcgggacgagtcggcggcggcgaacgagcacgacggcgggctaccc
gccggtccgctgtcggcgtgcgcggtgagcgcggcgttcacgctggcgcccggtgagcgt
cgcaacgtgacgttcgcggcggcttgggacctacccgcgagttcgttcccgaggggcgtc
aggtgggcgaagaggtacacccgataccacggatcgttcattcaccgccgggacgtgccg
cgcggtgccgccgcaccggacatcgcgacggaggcgttgctccgcgcggacgagtgggaa
ggtgacatcgcgcggtggcagcgggggttcgttcagtccgccgcggcgaaggacgccaac
ctggacgacccggccggcgggcggggaaggaactacccgggcagggtccgcgatcggccg
acgctgcgccgtcccgcgtggctcgtcggcgcgatgtttaacgagctgtactacctggtg
gacggtggcacgctgtggggccgaccgttaacggtggcgggtctcgaaggcgacgtcgag
gagtcggaggcttcggccgcggcgcccgggggttggcgcggcgaggacggcgagggggga
gacgcgcaggacgtcgcgggaaacgggggcgagtggggcggaaccctggggaggttcggt
ttgctggagagcttcgacgcgccggtgtacaacgccctggacgttcacttctacgggtcg
tggccgctcgccatgctctggcccgggctcgacctggctgtcctggccgacctggcggct
ggggtggactcggaggacgacgaggaacgcgcgctgtcgtggaacgcgcgggacgcgggg
cgcgcgcctgagatgaggaagaggaaggtgcggggttccgcgccgagggatctgggcgcg
ccgttcgatgcgccgctgacctcgtcgcccaacgcctttgacctcaccgacgtcaaccgt
tggaaggatctcgcgcccaagctcatgttaaccttggcgcgcgcgcacgccttgcggggc
gggttcaggggcccgaacgaccccgggggcatacctcgcgacgtactccggcgcatgttc
cggccgtgttacgagtccctcgccgcgcagcttcgaaggttcgacgggaacggcgacggg
ttgatagagcacgacgacgacgacgaagcggggccggaccattcgttcgtcgcgtggcgc
gcgaggggtgacacgtcggcgtacgcgggcgggctgtggctcgccgcgctgcgcgcgggc
gcggggctggcgagggacctcaacgagacgcacgcgcgtgatagcctggagcaaacgatg
cgagccgcggctgtcgcccacgacgccgcgctctggctcggcgacgacgacggcggccga
gggtactaccgcttcgacgcgagcgggacggaggggggcgacgtgtcgtccgcggcgcag
gtcatgggcgagtgggcgctcgcggtgatcggcgctcgcggtgtcctgcccgcgcgcaag
gttcgcgcggccctggcctccgtcgctcggctcaacgtcgccgccgcggggggcgcgggg
ggcgccgtcaacggagccgccgcgtcgggttccgtggatgccgtcagcgcgcactcgaac
gaggtttggccgggggtgtcgtacgcggtcgcgtcgcacatgctcctggcgggtatggat
gatgaagcctgggagttggcgcgtggcgtggcggcggggacgtacgagcggggtttggcg
tttaggacccccgaggcttgggacgctcgcggcgggttccggtcagcgatgagccaacgg
gccgggtccgtgtgggcgatcgagcacgcgctgacgttgcgacacaggcgggaggtggcg
gcgtgggaaaaagccgggcgaggccgggtgaaagacgagctttag

DBGET integrated database retrieval system